KEGG   Bombyx mori (domestic silkworm): 105842864Help
Entry
105842864         CDS       T02817                                 

Definition
(RefSeq) skin secretory protein xP2-like
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 105842864
NCBI-ProteinID: XP_012552567
Position
Un
AA seq 267 aa AA seqDB search
GAADGGEFEAPSTATGAADGKVAATKRVAATRSSPALPRAAGSRTPPASVPAVSPLVSGV
PRGPCPSAAAGDPWPVLPPSRAVQRRSRLPSPRSREATAVERQQGSAGPRILGLPEPNCY
SLDEIIDRTVQAVMERLGGGLAALEAKRVVSGDAERSASTPAAVLGAAVTHSTPVQAPAT
RAGPGRDRAKRGGGANAKCTSQAPQPRPLPPPPSNMDEGWNVVARRGAKRAVPTAPQVDG
APATAASQAAPQQGRALVAAKKKKTKK
NT seq 805 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcagctgatggcggagaattcgaggctccgagcacagctacaggcgcagcagatg
gcaaggttgctgctaccaaacgggtggccgcgacgaggtcgtcgcccgcgttgccacgtg
ccgctgggtcgcggactcctccggcatctgtgccggcggtatcgccgctggtctccgggg
tccctcggggtccctgtccctcagcggcggctggcgacccgtggcctgtgctgccaccat
cgcgcgcggtacaacggcgttcgcgtctcccgtcgccgcggtctagggaggcgacggctg
tcgagcggcagcagggatccgcggggccacggatcttgggcctgccggaaccgaattgct
acagcctggacgagattatcgaccgcaccgtccaggctgtaatggaaaggctgggtggcg
ggctggcggctctcgaggcgaagcgtgttgtctctggtgacgctgagcggtctgcgtcta
cacctgccgcggtgttgggtgctgcggtgacccactccacccccgtacaggctccagcca
ctagggcgggcccggggcgagacagagccaagcgggggggcggcgctaatgcgaagtgca
catcgcaggcgcctcaaccccgtccgctgcctccgcccccgtctaacatggacgaggggt
ggaatgtggtggcccggcggggtgccaagagggccgtaccgacagctccgcaagtggacg
gagcaccggccaccgcggcgtctcaggctgctccccaacagggtcgagcgcttgtggccg
ccaagaaaaagaagacgaagaagaa

DBGET integrated database retrieval system