KEGG   Bombyx mori (domestic silkworm): 692997Help
Entry
692997            CDS       T02817                                 

Gene name
GSTz1, GST4
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00350  Tyrosine metabolism
bmor01100  Metabolic pathways
Module
bmor_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    692997 (GSTz1)
Enzymes [BR:bmor01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     692997 (GSTz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 692997
NCBI-ProteinID: NP_001037418
UniProt: Q2I0J4
Position
Un
AA seq 215 aa AA seqDB search
MGKQPVLYSYWRSSCSWRVRIALNLKEIPYDIKAVSLIKGGGEQHCNEYREVNPMEQVPS
LCIDGHTLIESLNIMHYLEETRPQRPLMPQDCFKRAKVREICEMIASGIQPLQNLIVLIY
VGEEKKKEWSQHWITRGFRAIEKLLSTTAGKYCVGDEITLADCCLVPQVFNARRFHVDLR
PFPIILRIDRELENHPAFRAAHPSSQPDCPPEVAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagccagtattatactcatactggcgcagctcatgctcctggcgagttcgc
atagcactcaatcttaaagaaataccatacgacataaaggctgtcagcctgattaaggga
ggcggagaacaacactgcaatgagtatagagaagtcaaccctatggagcaagtaccatct
ttatgcattgatgggcacactctaattgaatcattaaacatcatgcattatttagaggag
acaagaccacagagacctcttatgccgcaagattgctttaagagggcaaaagttcgtgaa
atttgtgaaatgatagcctcaggaatacagccattgcagaatctgattgtgctaatttat
gttggtgaggagaaaaagaaggaatggtcccaacactggatcacaaggggcttcagagct
atagaaaagttgctatcgaccactgccggaaaatattgtgttggtgatgagattaccctt
gccgattgctgcttagttccacaagtgttcaatgctagaagatttcatgttgatctacgt
ccgttcccaatcatcctccgcatagaccgtgaactggagaatcatcccgcattccgtgcg
gctcatccatcttctcagccagattgtcccccagaagttgctaaatga

DBGET integrated database retrieval system