KEGG   Bombyx mori (domestic silkworm): 693006Help
Entry
693006            CDS       T02817                                 

Gene name
yellow-8
Definition
(RefSeq) major royal jelly protein 1
  KO
K22203  dopachrome tautomerase [EC:5.3.3.12]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00350  Tyrosine metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    693006 (yellow-8)
Enzymes [BR:bmor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.12  L-dopachrome isomerase
     693006 (yellow-8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRJP
Motif
Other DBs
NCBI-GeneID: 693006
NCBI-ProteinID: NP_001296464
UniProt: H9B425
Position
Un
AA seq 446 aa AA seqDB search
MNLLFVLNLLFASNVYCVRIKYERTHYWRLFGYDIDGVIYTTDSDYEHKNGSILFRDEIL
EEHEKFLIQKNLVPNHVAFNYNSVIVSIPRTRPGIPFTINKMNTYNFRKNNYSPLLMPYP
TSKESENIISVYKTVEDGCERYWFVDTGFIDVPGVRRQAGPARIYIYKYRGDSIIFMADI
DPNVLKDGITAGLRSLTIDYIFPCNETFAYISDDNGDAVIAFSFEEKRFWRIERQITGSE
AWTFPIPQSILLYAENVIRYRKSPNETFVHYSDILKNTKISQRSGQDVTVDLSERNTNPS
GVLYDRNYDGNILFFTDESRTNLYCWNMDTPMDEDNVELLTDISRDNDFYISALDTVGRG
FNFMVNRFRGLVDNIYDGNAINFADYSIDIDKMLNNTKCNKPTRCSNFIDNWRNKIQRSI
GSTKYMVKHVSDEYIQSELERKERRG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgctatttgtattaaatttattattcgcctctaatgtttattgtgtacgtatt
aaatacgagagaactcattactggagattgttcggttacgacatagacggggttatatat
acgactgattccgactacgaacacaaaaatggttcaatcttattccgggacgaaatattg
gaagaacacgaaaagtttctaattcaaaagaatttggttccaaaccacgtcgccttcaat
tataatagtgtaatagtatctattccgaggacgaggccaggtataccattcacaatcaac
aagatgaatacttacaacttccgtaaaaacaattacagtccattactcatgccttatcct
acgtcgaaagaatcagaaaacattatatcggtctacaaaactgtcgaagacggctgtgaa
aggtactggttcgtcgatacggggttcatagatgtacctggcgtcagaagacaagctgga
ccggccaggatttatatttataaatatcgtggcgatagcattattttcatggccgacatt
gaccccaacgttctcaaagacggaataacggcaggtcttaggtctctgacgatcgactac
atattcccttgtaacgaaaccttcgcgtacatcagtgacgataacggtgacgctgtcatt
gccttttcgtttgaggaaaaacgtttctggaggatcgaacgtcaaatcactggaagcgaa
gcttggactttccctataccgcaatccattttactgtacgctgaaaacgttataagatac
aggaaaagtccgaacgagacatttgtacattattcagatattttgaaaaatacgaagatt
tctcaacgttccggccaagatgtgaccgtggatcttagtgaaagaaatacaaatccaagt
ggagttttatacgacaggaattatgacggcaacattttatttttcacggatgaatctcgc
actaatctgtactgttggaacatggacacgccgatggatgaagacaacgttgaactgctc
actgatatttccagggacaacgacttttacataagcgctttagatacagtagggcgagga
tttaatttcatggttaatagatttagaggcttagttgacaatatttatgatgggaatgca
atcaatttcgctgattacagcatcgacatagataaaatgttgaataatacaaaatgcaac
aaaccaacgagatgttcaaatttcattgacaattggagaaataaaatccagcgttctatc
ggttcaacgaaatacatggttaaacatgtaagcgatgagtacatacaatcagaactagaa
agaaaggaacgccgtggatga

DBGET integrated database retrieval system