KEGG   Bacillus velezensis: NG74_00229Help
Entry
NG74_00229        CDS       T03423                                 

Gene name
yfnB
Definition
(GenBank) Putative HAD-hydrolase YfnB
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bmp  Bacillus velezensis
Pathway
bmp00361  Chlorocyclohexane and chlorobenzene degradation
bmp00625  Chloroalkane and chloroalkene degradation
bmp01100  Metabolic pathways
bmp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NG74_00229 (yfnB)
   00361 Chlorocyclohexane and chlorobenzene degradation
    NG74_00229 (yfnB)
Enzymes [BR:bmp01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     NG74_00229 (yfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AIU80390
UniProt: A0A2D3DJS3
Position
199173..199886
Genome map
AA seq 237 aa AA seqDB search
MSHYRTLLFDIDNTLLDFTASETDALQKLFQGSKLELTAEVEARYKALNQGLWKAFEEGE
MTRDEVVNTRFALLFKEYGLEADGVLLNQAYRQYLEEGHQMIDGAYELIERLSPLFDLYI
VTNGVSRSQYKRLGDSGLYPFFKDVFVSEDTGFQKPMKEYFDYVFARIPGFSAEGGLIIG
DSLSADIKGGQMAGIDTCWFNPGKKANESGIIPTYEIHSLDELYDVLNVERKAAAHL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattaccgtacgttattatttgatatagacaatacgctgctggattttaccgct
tcagaaaccgatgctcttcaaaaattgtttcaaggttcaaagctggagctgacggcagag
gtggaagcccgttataaagcgttaaatcaggggctgtggaaagcgtttgaagagggggaa
atgacccgcgatgaagtggtgaatacacggtttgcccttttgtttaaagaatacggcctc
gaagccgacggcgtgctgttgaatcaggcgtaccgccaatacttagaagaagggcaccag
atgatagacggagcttatgagctgattgaacggctgagtcctttatttgatttatacatc
gtgacgaacggcgtctcaagatcacaatataagcggctgggcgactccggtctgtatccg
ttctttaaagatgtgtttgtatctgaggacacgggttttcaaaagccgatgaaggaatac
tttgattacgtgtttgcgagaattcccggtttttctgccgagggcggacttattatcggc
gattcactgagcgcggacataaaaggcggtcagatggcgggaattgatacgtgctggttt
aatcccggaaagaaagcaaatgagtccggaatcatcccgacatacgagattcattcgctt
gatgagctgtatgatgtgctgaacgtggagcggaaagccgccgctcatttgtaa

DBGET integrated database retrieval system