KEGG   Bacillus velezensis: NG74_00256Help
Entry
NG74_00256        CDS       T03423                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bmp  Bacillus velezensis
Pathway
bmp00564  Glycerophospholipid metabolism
bmp01100  Metabolic pathways
bmp01110  Biosynthesis of secondary metabolites
Module
bmp_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NG74_00256 (psd)
Enzymes [BR:bmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     NG74_00256 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AIU80417
UniProt: A0A2S7L5A2
Position
225137..225952
Genome map
AA seq 271 aa AA seqDB search
MFNTAAKVLYRSLIELTNNRLTSYLIKNFCESKLSKPVIPLFSKHYRINWNETERTASDF
DSLASFFIRDINLNLRPVAKEKNAIVSPVDGVVQTVGMINPNQTFMVKGKDYSFAELTGF
KSADHKYNGGCFAVLYLSPRHYHRFHSPVSCTYQKLAELGKRSYPVNTMGLKYGKDVLSK
NYRYVYELTRADQQMLMIPVGAMNINSIVQTNTGNRLETGEELGYFSFGSTVILVFEKDM
FTPSDNLTEGRELQVGQIIGYAESQEEASAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatactgccgctaaagttctttatcgttcattgattgaactgactaataatcga
ttgacgtcttatctcattaaaaacttctgtgaatcgaaactgagcaagccggtgattccg
ctgttttccaaacactatcgcatcaactggaatgaaacggaacgcacggcttctgacttt
gattcactggcgtcattttttattcgtgatattaatttgaatctccgccccgtggcaaaa
gagaagaacgccatcgtcagcccggtggacggcgtcgttcagacggtgggcatgattaat
cccaatcaaactttcatggtaaaagggaaggattattcgttcgccgaactgacggggttt
aaaagcgccgatcacaagtataacggcgggtgttttgccgtgctttacctgagcccgaga
cattaccaccgcttccattctcccgtcagctgcacgtatcagaagctggccgagctgggg
aaacgctcctatcccgttaatacgatggggttaaagtacgggaaagatgtgctctcaaaa
aattaccgttatgtgtacgagctgacccgtgctgatcagcagatgctcatgattccggta
ggtgcgatgaatattaactcgatcgttcagacaaacaccggaaacaggcttgagacgggg
gaagagctgggctatttttcatttggatcgaccgttattttagtattcgagaaagatatg
tttaccccttcggataacctgactgaaggccgtgaattacaggtcggccagatcatcggt
tatgcggagtcacaggaggaggcgtccgctttataa

DBGET integrated database retrieval system