KEGG   Bacillus velezensis: NG74_00338Help
Entry
NG74_00338        CDS       T03423                                 

Gene name
fdhA
Definition
(GenBank) Glutathione-independent formaldehyde dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bmp  Bacillus velezensis
Pathway
bmp00010  Glycolysis / Gluconeogenesis
bmp00071  Fatty acid degradation
bmp00350  Tyrosine metabolism
bmp00625  Chloroalkane and chloroalkene degradation
bmp00626  Naphthalene degradation
bmp00680  Methane metabolism
bmp01100  Metabolic pathways
bmp01110  Biosynthesis of secondary metabolites
bmp01120  Microbial metabolism in diverse environments
bmp01130  Biosynthesis of antibiotics
bmp01200  Carbon metabolism
bmp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NG74_00338 (fdhA)
  09102 Energy metabolism
   00680 Methane metabolism
    NG74_00338 (fdhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NG74_00338 (fdhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NG74_00338 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NG74_00338 (fdhA)
   00626 Naphthalene degradation
    NG74_00338 (fdhA)
Enzymes [BR:bmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NG74_00338 (fdhA)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     NG74_00338 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C FtsJ Shikimate_DH HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIU80498
UniProt: A0A1D9PFP4
Position
315684..316820
Genome map
AA seq 378 aa AA seqDB search
MKALTYQGKEHMEVKEVPAPAIQDERDVIVRITATGICGSDLHLYKNGIPADPGYIVGHE
PMGIVEETGSQVKKLKKGDRVVIPFNIGCGECHYCKHQMESQCDESNPNPHTDAGGLFGF
SEFNGNYPGGQAEYLRVPYADFSSFLVPADSELEDEQVLLLSDVMPTAFWSVQHSGVKKG
DTVVILGSGPIGLMAQKFAWKKGAKRVIAVDQVPHRLEHARRINGAETFNFSEHDEIGKL
LHEQTSGGADVVIDCVGMDGTPLSKEKTEQKPNQFGTISPILTASEAVKKFGTVQLTGAY
ISEADGFPLGDFFTRNVSLKMGQAPVIHLMPMLYQMIEQNEIDPTDIITHKMSLAEAPAA
YDIFDKKEDGNIKVILKP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcactgacataccaaggaaaagaacatatggaagtgaaagaagtcccggcaccc
gccattcaagatgagagagatgtcatcgttcgaatcaccgcaaccgggatatgcggttca
gaccttcatttatataaaaacggaatacccgccgatccgggttatatcgtcgggcatgag
ccgatgggaatcgttgaagaaacgggcagtcaagtcaaaaagctgaaaaaaggcgaccgg
gtcgtgattccttttaacatcggctgcggagaatgtcattattgcaagcaccagatggaa
agccagtgtgatgaatcaaatccaaaccctcatacagatgccggcggcttattcggtttc
tcggagtttaacggtaattatcccggcgggcaggctgaatatttacgtgttccttatgct
gatttctcttcttttctggttccggcagacagtgagcttgaagatgagcaggtgctgctt
ctgtcagatgtcatgccgaccgccttttggagcgtccagcacagcggagtgaaaaaaggg
gatacagtcgttattctgggatcaggcccgatcggcttaatggcgcaaaaattcgcgtgg
aaaaaaggagctaaacgggttatcgcagttgatcaagtcccgcaccgccttgaacatgcg
agacgcataaacggagcagagaccttcaatttttcagaacatgatgagatcgggaaactg
ctgcatgaacaaacgtcagggggcgcggatgtagtgattgattgtgtcggaatggacggc
acgccgctttcaaaagaaaaaacagagcaaaaaccgaatcagttcggaacgatcagtccg
attcttacagcatcagaagccgttaagaagttcggaaccgtgcagctcacgggcgcatac
atttctgaagcggacggctttccgctcggcgattttttcacacgcaacgtttctttaaaa
atgggccaggcacccgttattcatctgatgccgatgctgtatcaaatgatcgaacaaaat
gaaattgatccgacggatatcattacacacaaaatgagtcttgcggaagctcctgctgca
tatgatatatttgacaaaaaagaagatggcaacattaaagtgattttgaagccatag

DBGET integrated database retrieval system