KEGG   Bacillus velezensis: NG74_01061Help
Entry
NG74_01061        CDS       T03423                                 

Gene name
yhfS
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase YhfS
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmp  Bacillus velezensis
Pathway
bmp00071  Fatty acid degradation
bmp00072  Synthesis and degradation of ketone bodies
bmp00280  Valine, leucine and isoleucine degradation
bmp00310  Lysine degradation
bmp00362  Benzoate degradation
bmp00380  Tryptophan metabolism
bmp00620  Pyruvate metabolism
bmp00630  Glyoxylate and dicarboxylate metabolism
bmp00640  Propanoate metabolism
bmp00650  Butanoate metabolism
bmp00900  Terpenoid backbone biosynthesis
bmp01100  Metabolic pathways
bmp01110  Biosynthesis of secondary metabolites
bmp01120  Microbial metabolism in diverse environments
bmp01130  Biosynthesis of antibiotics
bmp01200  Carbon metabolism
bmp01212  Fatty acid metabolism
bmp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NG74_01061 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    NG74_01061 (yhfS)
   00640 Propanoate metabolism
    NG74_01061 (yhfS)
   00650 Butanoate metabolism
    NG74_01061 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NG74_01061 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    NG74_01061 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NG74_01061 (yhfS)
   00310 Lysine degradation
    NG74_01061 (yhfS)
   00380 Tryptophan metabolism
    NG74_01061 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NG74_01061 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NG74_01061 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NG74_01061 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmp04147]
    NG74_01061 (yhfS)
Enzymes [BR:bmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NG74_01061 (yhfS)
Exosome [BR:bmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NG74_01061 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIU81172
Position
complement(1026461..1027552)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSMYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKANEDGLYRREILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
RLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacgattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgattcgccatttgagccgaaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccggacttcctttgagcgtgtccggtacgaccatcgacaga
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttgttaaagccggcgcg
gggagcatgtacatcgcgggaggagcggagagcagcagccgttcccctttctcttcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgaacgaagacggcttataccgccgggaaattcttccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aaacccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggtgcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagcca
agattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagcc
ccggtttatgccgtcaaaaagcttttgaaggaacggaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system