KEGG   Bacillus velezensis: NG74_03708Help
Entry
NG74_03708        CDS       T03423                                 

Gene name
nfrA1
Definition
(GenBank) FMN reductase (NADPH)
  KO
K19285  FMN reductase (NADPH) [EC:1.5.1.38]
Organism
bmp  Bacillus velezensis
Pathway
bmp00740  Riboflavin metabolism
bmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NG74_03708 (nfrA1)
Enzymes [BR:bmp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     NG74_03708 (nfrA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase Mvb12 TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AIU83714
UniProt: A0A235BFM8
Position
complement(3720853..3721602)
Genome map
AA seq 249 aa AA seqDB search
MNNTIETILNHRSIRSFTDELLTAEEIDTLVKSAQAASTSSYVQAYSIIGVTDKEKKRKL
AALAGNQPYVENNGHLFVFCADLYRHKKLAEEKGENITELLENTEMFMVSVIDAALAAQN
VSVAAESMGLGICYIGGIRNELDQVTEVLGTPDHVLPLFGLVVGHPAHPSGQKPRLPKQA
VYHENTYDTNEEHFRSYMKEYDETISAYYDKRTNGKRVETWSDQILQFMKQKPRTYLNQY
VKDKGFQKN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataccatcgaaactatacttaatcatcggtcgatccgatcatttactgacgag
cttctgacagcagaagagatagatacattagtgaaaagcgcccaggcggcgtcaacgtcc
agttacgtgcaggcttactccatcatcggcgtaactgataaggagaaaaagcggaagctg
gcggcactggccggaaaccagccttacgtcgaaaataacgggcacttgtttgtgttttgc
gctgatttgtaccgtcataaaaaacttgctgaggaaaaaggcgaaaacattacagagctt
cttgagaatacggaaatgtttatggtcagcgtcattgatgccgcacttgccgcacaaaac
gtaagtgttgccgcggaatcaatgggacttggcatttgttatatcggaggcattcgaaat
gaacttgatcaggtgacagaagtgcttggaacacctgaccatgtgctgccgctgttcggc
ttggtagtcggtcatcccgctcatccgtccggtcaaaagccgcgcctgccgaaacaagcc
gtatatcatgaaaacacgtacgatacgaatgaagaacacttccgcagttatatgaaggaa
tatgatgaaaccatttccgcttattatgataaacggacaaacggcaagcgggttgaaacg
tggtctgatcaaatcctgcagttcatgaaacaaaaaccgagaacctatttaaatcaatat
gtaaaagataaaggttttcaaaagaattaa

DBGET integrated database retrieval system