KEGG   Bacillus megaterium QM B1551: BMQ_0191Help
Entry
BMQ_0191          CDS       T01208                                 

Gene name
argI
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00220  Arginine biosynthesis
bmq00330  Arginine and proline metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01130  Biosynthesis of antibiotics
bmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BMQ_0191 (argI)
   00330 Arginine and proline metabolism
    BMQ_0191 (argI)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BMQ_0191 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADE67292
UniProt: D5DVX7
Position
160889..161788
Genome map
AA seq 299 aa AA seqDB search
MNKLSIIGVPMDLGQTRRGVDMGPSAIRYAGVIERIENIGYSVEDKGNIEIALAERVHSD
ENTNLKNLKAVADASERLAQTVSDVITNKRFPLVLGGDHSIAIGTLAGVSRHYKNLGVIW
YDAHGDLNTADTSPSGNIHGMPLAASIGIGDDALTRIGGYTPKVKPENIVIIGARSLDEG
EKELIKEKGIKVYTMHEIDRMGMTKVMEETILYLRDKTDGVHLSLDLDGLDPHDAPGVGT
PVIGGISYRESHLAMEMLAESQLITSAEFVEVNPILDERNKTATVAVALMGSLLGEKLV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctttcaattattggagtaccaatggatttaggtcaaactcgccgaggggtc
gatatggggccaagtgcgatacgatatgcaggtgttattgaacgcatcgagaatattgga
tatagtgtagaagataaagggaatattgaaattgccttagctgaacgagtacatagtgat
gaaaatacaaacttaaagaatttaaaagctgtagcagatgctagcgagaggcttgctcag
accgtaagtgatgttattacaaataaaaggtttcctttagtactggggggagatcacagc
atcgctatcggaacactagcaggagtaagtcgtcattataaaaacttgggcgtgatttgg
tatgatgcacacggagatttgaatacagcagatacgtctccttcaggaaatattcacggt
atgccattggcggcaagtataggtataggagacgacgcattgactcgaattggtggttat
acacctaaagtcaagccggaaaatattgtgattatcggagcacgttctttagatgaagga
gaaaaagagttaataaaggaaaaagggattaaagtgtatacgatgcatgagatagatcga
atgggtatgacaaaagtaatggaagaaacaattttatatttgcgtgataaaacagatggc
gttcatctatcactcgatttagatggattggatccacatgatgcacctggagtaggaacg
ccagttatcggtggaataagctacagagaaagtcatttagctatggagatgttagcagaa
tctcagctaatcacttctgctgagtttgtggaagtaaatcctattttagatgaacggaat
aaaacagctaccgtagctgttgcattaatgggctcacttttaggagagaaattagtataa

DBGET integrated database retrieval system