KEGG   Bacillus megaterium QM B1551: BMQ_0204Help
Entry
BMQ_0204          CDS       T01208                                 

Definition
(GenBank) mannitol dehydrogenase domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00051  Fructose and mannose metabolism
bmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMQ_0204
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BMQ_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 UDPG_MGDP_dh_N TrkA_N 3HCDH_N Sacchrp_dh_NADP Big_3_4
Motif
Other DBs
NCBI-ProteinID: ADE67305
UniProt: D5DWR0
Position
176873..178015
Genome map
AA seq 380 aa AA seqDB search
MKQAVHFGAGNIGRGFIGALFSQSNYHVTFVDIAEKVINQLNADKGYNVVTAAEHAETLA
VQNVSGLNNLTQEQAVIKAIKEATYITTAIGPNVLPRIAPLIAKGLAERVKTSDENVYVI
ACENQISATDLLKGYIFDALDEETKAHMINKVFFFNSAVDRIVPIQHNQGSLDVLVESYY
EWVVEAPEDIPFVEGMTIVPDLAPFIERKLFTVNTGHAVIAYFGYLKGKETIDQTLRDSD
IYEQVQQTLQETGNYLIKRYDLDREEHEAYITKIIERFKNPHLNDSVKRVGRAPIRKLGP
QDRLIRPALEAKKVGLSYTYLAKAIAAALLFDPQEDKEAMKLQANIHEYGIEYVLKEVSG
LEASDDLTKEIIAQYNALKS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaagcagttcattttggagcaggcaatattggtcgaggattcattggggcattg
ttttctcaaagcaactatcacgtcacattcgtagatattgctgaaaaggttattaatcag
ttaaacgcagataaagggtataacgtagtgacagctgcagagcacgcggagacattagct
gttcaaaacgtatctggtttaaataatctgacacaagaacaagccgtcattaaagcgatt
aaagaagcaacgtacattacgacggccatcggaccgaacgttctgccgcgaattgctcct
ttaattgctaaaggtttggctgaacgtgtaaaaacaagcgacgaaaatgtatatgtgatt
gcatgtgaaaatcaaatctctgcgacagatttattaaaaggctatatttttgacgcgctg
gatgaagagacaaaagctcatatgataaataaggtctttttctttaattcagctgtagat
cgtatcgtgcctattcagcataaccaaggttcgcttgatgttttagtagaatcctattat
gaatgggtagtagaggcacctgaagatattccttttgtagaaggaatgacgattgtgcct
gaccttgctccttttattgaaagaaagttatttacagtgaatacgggacacgcggtaatt
gcatattttggttatttaaaaggaaaagaaacgattgatcaaacgttaagagattcagat
atttacgaacaagtacagcaaacgctacaagaaacaggaaactatctaattaaaagatat
gacttagatagagaggaacacgaagcctatattactaaaatcattgaacgctttaaaaat
cctcatttaaatgattcagttaaaagggtaggaagagcgccaattcgcaagcttggacct
caggatcgcttgattcgtccagcgctagaagcaaaaaaagtgggcctttcttacacctac
ttggcaaaggctatcgccgctgcgcttttatttgacccgcaagaagataaagaggctatg
aagcttcaagcgaatattcatgagtatggtattgagtacgtgttaaaagaggttagtggg
ttagaggcaagtgatgatttaacaaaagaaatcattgctcaatataatgctttaaagtcg
tga

DBGET integrated database retrieval system