KEGG   Bacillus megaterium QM B1551: BMQ_0600Help
Entry
BMQ_0600          CDS       T01208                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00860  Porphyrin and chlorophyll metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMQ_0600 (hemG)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BMQ_0600 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BMQ_0600 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 Thi4 MCRA Pyr_redox Trp_halogenase HI0933_like AlaDh_PNT_C FAD_binding_2 GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADE67656
UniProt: D5DZ14
Position
561756..563177
Genome map
AA seq 473 aa AA seqDB search
MTDRRKKVVIIGGGITGLSAAYYLQKKIKDHQLPIDLQLIEATHRLGGKIQTVKRDGYLF
EKGPDSFLARKLAATKLAKEVGLGRELVGNEKGKSYILVKDTPHALPDGAVMGIPTKLSP
FITTGLFSPVGKLRAAADFFIPKTKNQDDRSLGVFFRRRFGDEVVENLIEPLLSGIYAGD
VDRLSLRSTFPQFLHAEHKYRSLIVGMKKLKEIHPQHGDDSEFKKNSVFLTLKEGLQSLV
DGVEKAIDPDIITKGIKVEKIYKEDTTYELSLNSGKVIKADSVIVTSPHAAAQSMLSEYK
IFEPLKHMPSTSVATVVIAFAQEALQDNLDAMNIAVSRNSDYTITACTWLNKKWPHAVPE
GKVLLRCLVGRTGDEAVVDQPDDEIFKIVLEDLKKLITISAEPEFYAVTRWKQSMPQYTV
GHHDMLDTMNEQLEKELAGLYVAGSSYEGLGIPECVEQGEDVAKKAVKYVQQL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacggatagacgaaaaaaggttgtcatcatcggtggaggaataacaggtctttcagct
gcctattatttgcaaaaaaaaataaaggatcatcagctgccaattgatcttcaactaata
gaagcgacgcatcggcttggtggaaaaattcaaacggtcaaacgagacgggtatttattt
gaaaaaggtcctgattcatttttagcgcgtaagctagctgctacaaaactggcaaaagaa
gtagggttaggcagggagctagtcggaaatgaaaagggaaaatcctatattctagtaaaa
gatacaccgcatgcgctgcctgatggtgctgtaatggggataccaaccaagttatctcct
tttatcacaacagggttattttcacctgttggcaagctgcgcgcagcagctgattttttt
ataccgaagacaaaaaatcaggatgaccgttcgctaggcgtattttttagaagacggttt
ggtgatgaagttgttgaaaatttaattgagcctctattatcaggaatttacgcaggagac
gttgatcgtttgagtttaagatcaacatttccacagtttttgcatgctgaacataagtac
agaagcttaattgttggaatgaaaaagctaaaagaaattcacccacagcacggtgatgat
tcggagtttaaaaaaaatagtgtctttttaacattaaaagaaggtcttcaatcgctagta
gatggggtagaaaaagcaatagatcctgatattattacaaaaggaataaaagtagagaaa
atttataaagaagataccacatatgaattatcgttaaatagcgggaaagtcataaaagca
gatagcgttattgtaacttctcctcatgcagctgctcagtctatgctttcggaatataaa
atattcgagccgttgaagcatatgccttccacttcagtagctactgttgtgatagccttt
gcacaagaagcgctgcaagacaatctagatgcaatgaacatcgccgtttcaagaaatagc
gattacacgattacggcgtgcacatggctaaataaaaagtggccgcatgcggttccggaa
gggaaagtgctgctgagatgtttagttggacgaaccggggatgaagctgtggtggatcag
cctgacgatgaaattttcaaaattgtcctggaggatttgaagaagctcatcaccatttct
gctgagcctgaattttacgcggtaacgagatggaagcagtcaatgcctcaatatacggtc
ggacatcacgatatgctagatacgatgaacgaacagcttgaaaaagagctggccggtctt
tatgtagcgggaagctcatacgaaggtctgggtataccagaatgtgtagagcaaggagaa
gatgtggctaaaaaagcagttaaatatgtgcagcaactgtag

DBGET integrated database retrieval system