KEGG   Bacillus megaterium QM B1551: BMQ_1348Help
Entry
BMQ_1348          CDS       T01208                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00020  Citrate cycle (TCA cycle)
bmq00620  Pyruvate metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_1348 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BMQ_1348 (pdhC)
   00620 Pyruvate metabolism
    BMQ_1348 (pdhC)
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMQ_1348 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADE68381
UniProt: D5E0B8
Position
1332076..1333374
Genome map
AA seq 432 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKAGDEIDEDDVLAEVQNDKAVVEIPSPVKGKVLEVK
VDEGTVATVGQVIVTFDAPGYEDLKFKGDDHDDAPAEEAKEEASTEEVTEEATAPAAQAD
VDPNRKVIAMPSVRKYAREKGVDIKAVPGSGKNGRIVKDDIDSFLSGGSTATATAEAPAK
EETASAEPKAAAQAIPEGDLPETREKMSGIRRAIAKAMVNSKHTAPHVTLMDEIDVTALV
AHRKKFKTVAADQGIKLTFLPYVVKALTSALKKFPALNTSIDDSTDEVIQKHYYNIGIAA
DTEKGLLVPVVKNADRKSVFEISDQINDLAGKARDGKLAPAEMKGASCTITNIGSAGGQW
FTPVINHPEVAILGIGRIAEKPVVRDGEIVIAPVLALSLSFDHRIIDGATAQNALNQIKR
LLNDPELLLMEA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactgccggatatcggtgaaggtatccacgaaggtgaaattgta
aaatggttcgtaaaagctggagatgaaattgatgaggatgatgtactagcagaagtacaa
aatgacaaagctgttgttgaaatcccatctcctgtaaaaggtaaagtattagaagtaaaa
gttgacgaaggtacagtagctactgtaggacaagttatcgttacttttgatgctcctgga
tacgaagacttaaaattcaaaggtgacgatcatgatgatgcaccagcagaagaagctaaa
gaagaagcttcaactgaagaagtgactgaagaagcaacagctcctgcagcacaagctgat
gttgatcctaaccgtaaagtaattgctatgccttcagtgcgcaaatatgctcgtgaaaaa
ggtgtagacattaaagctgttcctggttcaggtaaaaacggacgtattgttaaagatgac
atcgatagcttcctatctggtggttctacagctacagcaactgctgaagctccagctaaa
gaggaaactgcttcagctgaaccaaaagcagcagcacaagctattcctgaaggcgactta
ccagaaactcgcgagaaaatgagcggtatccgtcgtgcaatcgcaaaagctatggttaac
tctaaacacactgctccacacgtaacattaatggatgaaatcgatgtaacagctcttgtt
gctcatcgtaaaaaattcaaaacagttgcagcagatcaaggtattaaattaacattctta
ccttacgtggtaaaagcgttaacttcagcacttaagaagttcccagctcttaacacttca
atcgatgactctacagatgaagtaattcaaaaacattactacaacatcggtatcgctgct
gacactgaaaaaggtcttttagtaccagttgtgaaaaatgctgaccgtaaatctgtgttc
gaaatttctgatcaaattaacgaccttgctggaaaagcacgtgatggtaaattagctcct
gctgaaatgaaaggcgcttcttgtacaatcacaaatatcggttctgctggtggacaatgg
tttactcctgttatcaaccacccagaagttgcaattctaggtatcggacgtatcgctgaa
aaaccagttgtacgcgacggtgaaattgtaattgctccagtattagcattatcactaagc
tttgaccaccgtattatcgatggcgcaacagctcaaaacgctcttaaccaaatcaagcgt
ttattaaatgatccagaattattattaatggaggcgtaa

DBGET integrated database retrieval system