KEGG   Bacillus megaterium QM B1551: BMQ_1369Help
Entry
BMQ_1369          CDS       T01208                                 

Gene name
pycA
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00020  Citrate cycle (TCA cycle)
bmq00620  Pyruvate metabolism
bmq01100  Metabolic pathways
bmq01120  Microbial metabolism in diverse environments
bmq01200  Carbon metabolism
bmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_1369 (pycA)
   00620 Pyruvate metabolism
    BMQ_1369 (pycA)
Enzymes [BR:bmq01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BMQ_1369 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 RnfC_N HlyD_3 GCV_H RimK ATPgrasp_ST NQRA YqfD
Motif
Other DBs
NCBI-ProteinID: ADE68401
UniProt: D5E0D8
Position
1350575..1354024
Genome map
AA seq 1149 aa AA seqDB search
MSFVTKKIKKVLVANRGEIAIRVFRACTELNIRTVAIYSKEDAGSYHRYKADEAYLVGAE
KKPIDAYLDIEGIIDIAKSHDVDAIHPGYGFLSENIQFAKRCEEEGIIFIGPKSKHLDMF
GDKVKARHQAIQADIPVIPGTDGPIDSIDEAKEFANQHGYPLMIKAALGGGGRGMRIVRD
ADSLNESYDRAKSEAKAAFGNDEVYVEKLVENPKHIEVQILGDEQGNVVHLYERDCSVQR
RHQKVVEVAPSVSIDEGLRLRICEAAVQLMEKVQYINAGTVEFLVSGNDFYFIEVNPRVQ
VEHTITEMITGIDIVQSQILIADGYALHSKEVSIPAQDQIHVHGYAIQSRVTTEDPLNNF
MPDTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKVTTWALTFDQAASKMVRNL
KEFRIRGIKTNIPFLENVVKHDKFLTGAYDTSFIDTTPELFVFPKRKDRGTKMLTYIGNV
TVNGFPGVSEKKKPIFTKPRVPSVDISKPIQNGTKQILDEKGAEGLVNWVKERKEVLLTD
TTFRDGHQSLLATRIRTNDLKQVANPTARLLPDLFSMEMWGGATFDVAYRFLKEDPWDRL
LTLRQQAPNVLFQMLLRASNAVGYKNYPDNVIKEFVEKSAYAGIDVFRIFDSLNWVQGMT
LAIDSVRQTGKIAEAAMCYTGDILDPTRRKYDLDYYKNLAKELEQSGAHILGIKDMAGLL
KPQAAYDLVSALKETVDIPIHLHTHDTSGNGVYTYAKAIEAGVDIVDVAVSSMAGLTSQP
SANSLYYALEGADRRPNLDIKNLEQLSYYWEDVRKYYQDFESGMNAPHTEVYEHEMPGGQ
YSNLQQQAKAVGLGNRWDEVKDMYSRVNLLFGDIVKVTPSSKVVGDMALFMVQNNLTEET
LFERGETLDFPDSVIELFEGYLGQPHGGFPKELQRIILKGRKPITVRPGELLEDVDFDAV
KEKLFKDLNRQVTSFDAIAYALYPKVFMDYHKAVEQYGDISVLDTPTFLYGMRLGEEVEI
EIEKGKTLIVRLVSIGEPQADGTRAVYFELNGQPREVVIKDESVKTTVTAKQKADQGNPA
HIGASMPGTVIRVVVEKGDKVSKGDHLMITEAMKMETTVQAPFDGVIKQVHVSSGDGIQP
GDLLIELES
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgtaactaaaaaaatcaaaaaagtattagtagcaaaccgaggagaaattgca
attcgtgtatttcgagcatgtactgaactgaatattcggactgttgcgatttattctaag
gaagatgcaggctcttatcaccgttacaaagcggatgaagcctatttagtaggagcggag
aaaaaaccgattgatgcttatttagatatagaaggcatcatcgacattgctaagtctcat
gatgtagatgctattcaccctggctatggttttttgtcagaaaatatccaatttgcgaaa
cgttgcgaagaagaaggcattatttttattggcccaaaatccaagcatcttgatatgttt
ggcgataaagtaaaagcacgtcatcaggctattcaagcagatattcccgttattcctggt
acggatggtcctattgattcaattgacgaagcaaaagaatttgctaatcagcatggatat
cctctaatgatcaaagcggctttaggcggaggcggtcgaggcatgcgtatcgttcgcgat
gcagacagcctgaatgaatcttatgaccgtgccaaatcagaagcaaaagcggcttttggt
aatgatgaagtgtatgtcgagaaattagttgaaaatccaaaacatattgaagtgcaaatt
ttaggtgatgaacaaggaaatgttgtgcatctttatgaacgcgactgttctgtgcagcgt
cgtcaccaaaaagtagtagaagtagcaccaagtgtttctatagatgaaggcttacgtctc
cgcatttgtgaagcagctgtgcagctgatggaaaaagtgcagtacataaatgctggtaca
gtagaatttttagtatcaggaaacgatttttattttattgaagtaaatccacgtgttcaa
gtagagcacacaattactgaaatgattacaggtattgatatcgttcaatcgcaaatttta
attgcagacggttacgcgcttcacagcaaggaagtgtccattcctgcacaagatcaaatt
cacgtacatggatatgcgattcaatctcgtgtaacgacagaagatccgttaaacaatttt
atgccggatacgggtaagattatggcttatcgttctggtggcggttttggcgtacgttta
gatacgggaaacagcttccaaggtgctgtaattacgccttattatgattcactgttagta
aaagtaacaacatgggcattaacattcgatcaagccgcatcaaaaatggtacggaactta
aaagaatttcgtattcgtggaattaaaacaaatattccgtttcttgaaaatgtagtgaag
catgataagttcttaacaggtgcttatgatacatcatttattgacacaacgcctgaactt
tttgttttcccgaagcgaaaagaccgcggaactaaaatgcttacatacattgggaatgtt
acggtaaacggattcccaggtgtatcggaaaagaaaaagccgatctttacgaaaccgcgc
gttcctagtgtggatataagcaaaccaattcaaaacggaacaaagcaaattttagatgaa
aaaggtgcagaaggtttagtaaattgggtgaaagaacgcaaggaagtgctattaacggat
acaaccttccgtgatggccatcagtctcttttagcaacgcgtatccgtacaaacgactta
aaacaagtagctaacccaactgcacgcttgcttccagatttattttctatggaaatgtgg
gggggagcaacgtttgatgtcgcttatcgattcttaaaagaagatccgtgggatcgcttg
cttactttacgtcaacaagcgccaaacgttcttttccaaatgcttcttcgcgcgtcaaat
gcggttggatataaaaactatcctgataatgtaattaaagaatttgttgaaaaatcagct
tatgcaggtattgatgttttccgtatctttgacagcttaaactgggtgcaaggaatgact
cttgcaattgactccgttcgtcaaacaggaaagattgcagaagcagcgatgtgttataca
ggtgatattttagatccgacgcgccgtaagtatgatttggattactacaagaacttagca
aaagagcttgagcagtctggagcacatatcctgggcattaaagatatggcgggtctttta
aaaccacaggcagcttatgatttagtatcggctctaaaagaaacggttgatattccaatc
caccttcatacgcatgatacaagcggaaacggtgtatacacgtatgcaaaagcaattgaa
gcaggtgtagacattgtagacgtagccgtaagctcaatggcaggcttaacgtctcagcca
agtgctaactctctttattacgcattagaaggtgcggaccgcagaccaaatctggatatt
aaaaatctagaacagctttcttactattgggaagacgtgcgaaaatattaccaagacttc
gaaagcggcatgaacgctcctcatacggaagtgtacgagcatgaaatgccagggggtcaa
tatagcaacttacagcaacaagcaaaagcagttggtttaggaaaccgctgggatgaagta
aaagatatgtattcacgcgtgaatttgttatttggtgatattgtaaaagttacgccatca
tcaaaagtagttggagatatggcattgtttatggttcaaaacaacttgacagaagaaacg
ctgtttgagcgcggtgaaacgcttgacttcccggattcagttattgaattgtttgaaggg
tatttagggcagcctcacgggggattccctaaagagcttcagcgcatcattctaaaaggc
agaaaacctattacagttcgtcctggagaattgttagaagatgtggacttcgatgcagtg
aaagaaaagctgtttaaagacttaaatcgtcaagtaacgagttttgatgccattgcttat
gcgctgtatccaaaagtatttatggattaccacaaagcagtcgaacaatacggggacatt
tctgttcttgatacaccgactttcctatacggcatgcgtttaggagaagaggttgaaatt
gagattgaaaaaggaaaaaccttaattgtccgccttgtatccattggagaaccgcaggca
gacggtacgcgagcggtatactttgaattgaacggtcagcctcgtgaagtcgtgattaaa
gacgaaagtgtcaaaacaaccgttacggcaaaacaaaaagccgaccaaggaaatccggcc
cacatcggcgcttcaatgcctggaaccgttattcgagtagtagtagaaaaaggcgataaa
gtctcaaaaggtgatcacttaatgatcacagaagcaatgaaaatggaaacaaccgtgcaa
gcaccatttgacggcgtgattaaacaagtacacgtgtcgagtggagatggcatccagccg
ggagatctgttaattgaattagaaagctaa

DBGET integrated database retrieval system