KEGG   Bacillus megaterium QM B1551: BMQ_1552Help
Entry
BMQ_1552          CDS       T01208                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00430  Taurine and hypotaurine metabolism
bmq00460  Cyanoamino acid metabolism
bmq00480  Glutathione metabolism
bmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BMQ_1552 (ggt)
   00460 Cyanoamino acid metabolism
    BMQ_1552 (ggt)
   00480 Glutathione metabolism
    BMQ_1552 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bmq01002]
    BMQ_1552 (ggt)
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BMQ_1552 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BMQ_1552 (ggt)
Peptidases and inhibitors [BR:bmq01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BMQ_1552 (ggt)
CD molecules [BR:bmq04090]
 Proteins
  BMQ_1552 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ADE68584
UniProt: D5E1N4
Position
1531538..1533226
Genome map
AA seq 562 aa AA seqDB search
MINGKSLSRSGKSSYRRETAVGKTGMVASAHPIATDAGEQVLRAGGNAIDAAIAVQFGLN
VGEPMMTGIGGSGFFMVYHNESKTTKIFDGHSQAPKAAYPEMFLDENKEVIPFRKRSTHA
TAIGIPGILKAMEAARKEYGTKPLAELIEPAAKAAEAGVETNWVLGDILKTYAYRLGEHA
KQLYSPNGKPMQEGDMINKKDLAKTFRILQEKGIEAFYEGEIAEAIISTIKEHGGFMELS
DLKEYQIKIDEPVWGDYKGHRIASSNMPSAGGTTVLQILKLLEDFDVSQYDVKSWEKYYL
FAEAMRIAFSDKIAFSGDPVYSDIPLKGLLNDEYIKERQKLINWKHKNEKVDFGNPWDYE
KGQKVNVVRQPYEPERELSETTHFTVVDRWGNIVACTSTVEHPFGTGIMVKDHGFLLNNE
LTDFDAIPGGLNQADAGKRPVSCKSPTIVFKDSEPVLTLGSPGGPTIVGSVFQTLMNVLD
YGMDIKEAIEEPRIFNSTGSLIGWEAGVDMNAKGELEAMGFNFGDEPFPIGNVQGIQIDK
ETGRLFGAADSSREGKATGLDS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgattaatggaaaaagtttatctcgttcaggaaagagttcatatagaagagaaacagcg
gttggaaaaacaggaatggtagccagtgctcatccaattgcaacagacgccggagaacag
gtgctaagagccggaggcaatgcaattgatgcagcaattgccgttcagtttgggctcaac
gttggagaaccgatgatgaccggtattggaggcagcggcttttttatggtataccacaat
gaaagcaaaacaactaaaatttttgacgggcattctcaggctcctaaagcagcgtatcct
gaaatgtttcttgatgaaaataaagaagttattccatttagaaagcgttctactcatgca
acggcaattggaattccagggattttaaaggcgatggaagcagctcgtaaagagtatgga
acaaaaccccttgctgaattgattgaaccggctgccaaagcagcagaagcaggtgtggaa
acaaactgggttcttggagatattttaaaaacatatgcctaccgactaggagaacatgct
aagcagctatattccccaaacggcaagcctatgcaagaaggagatatgattaataaaaaa
gatcttgctaaaaccttccgcattcttcaagaaaaaggtatcgaggctttttatgaaggt
gaaattgcagaagccattatttcaacgatcaaagagcacggcggttttatggaactgtcg
gatttgaaagaataccagattaagatcgatgagcccgtgtggggagattataaaggacac
cgaattgcttcttccaacatgcctagtgcaggaggaaccactgtgctgcaaatcttaaag
ctattagaggactttgatgtgtctcagtacgacgtgaaatcttgggaaaagtattatttg
tttgcagaggctatgcgcattgcattttcagataaaattgcattctctggagatccagtc
tacagtgacattccattaaaagggcttttaaatgacgaatatataaaggaacgtcaaaaa
ttaattaattggaagcataaaaatgagaaagttgattttggcaacccgtgggattatgag
aaaggccaaaaagtgaacgttgtgcgtcagccttatgaacctgaacgtgagcttagtgaa
acaactcacttcacggtagttgaccgctggggcaatattgtcgcttgtacatcaactgtg
gaacatccttttggtacaggaattatggttaaagaccatgggtttttactcaacaacgag
cttactgattttgatgctattcctggagggttaaatcaagcggatgcaggaaagcgtccg
gttagctgtaaaagtccaaccatcgtttttaaagacagcgaacctgtactcactttagga
tctccaggtggaccaacgattgtagggtctgtgtttcaaacgcttatgaatgtcttagac
tatggaatggatataaaagaagcgattgaagaaccaagaatttttaatagtacaggatca
cttatcggttgggaagccggagtggatatgaatgccaaaggagagctagaagccatggga
tttaattttggagatgagccattcccaatcggaaatgttcaaggtattcaaattgataaa
gaaaccggccgtttatttggagcagctgattccagccgtgaaggaaaagcaactggctta
gactcttaa

DBGET integrated database retrieval system