KEGG   Bacillus megaterium QM B1551: BMQ_1884Help
Entry
BMQ_1884          CDS       T01208                                 

Gene name
bdhA
Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMQ_1884 (bdhA)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BMQ_1884 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BMQ_1884 (bdhA)
    1.1.1.-  
     BMQ_1884 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADE68913
UniProt: D5DPJ2
Position
1886052..1887101
Genome map
AA seq 349 aa AA seqDB search
MKALRWHGVKDVRLEHIAEPTVSQGKVKIKVEWCGICGSDLHEYTAGPIFIPTEEPHPLS
KDKAPVVLGHEFSGQIVEIGEGITNVKVGDRVVVEPIYACGECENCKQGKYNLCNKMGFY
GLAGGGGGFSEYASIPVEMIHKIPEVVSYEQGALVEPSAVALHAVRQSKLKVGDKAAVFG
TGPIGLLVIEALKASGASEIYAIELSEQRRQKAEELGAIVINPQEYDPVAELYKRTGGGV
DVSYEVTGVPLVLTQAINSTKSGGETMIVSIFEKEASIHPQTIVLQERTVTGIIGYRDVF
PAVISLMAKGYFSADKLVTKRIKLENVIEEGFETLLKEKEQVKILVKAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaagatggcatggcgttaaagatgtaaggttagaacatattgcagaacct
accgtctctcaagggaaagtgaaaattaaagtagaatggtgtggaatttgcggaagtgat
ttgcatgagtacacggcaggacccatttttattcctacagaagaaccccatccattaagt
aaagataaagcgccggttgtgctggggcatgaattttctggacaaattgtagaaatcgga
gaaggtattacgaatgtaaaagtcggagacagagtagtggtagaacctatctatgcatgc
ggagagtgtgaaaactgtaaacaaggaaagtataatctttgtaataaaatggggttttat
ggtcttgccggaggtggcggaggtttttctgagtatgcctccataccggtagaaatgatt
cataaaataccggaagtggtatcttacgagcaaggagctctcgtagagccttcagctgtg
gctcttcatgctgtgcgtcaaagcaaactaaaggtaggagataaagctgccgtatttggg
acgggaccaatcggtttgttagttattgaagcgttaaaagcatcgggtgcatctgaaatt
tatgcgatcgaactatcggaacagcgcagacagaaagctgaagaacttggggcgattgtg
attaacccgcaagaatacgaccccgtagcagaattatataagcgcacaggtggaggtgtg
gatgtttcctatgaagtgacgggtgttcccttagttttaactcaagccattaattctacc
aaaagtggtggggagacaatgattgttagcatatttgaaaaagaagcgtccattcatccc
caaacaatcgttttacaagagcgtacagtaacaggtattattggctaccgcgatgtattt
ccagcggttattagtttaatggcaaaaggctatttttctgctgataaactggtgacaaaa
cgtatcaagctagagaatgtaattgaagaaggttttgagacattgttaaaagaaaaagaa
caggtgaaaattttggtgaaagctgaataa

DBGET integrated database retrieval system