KEGG   Bacillus megaterium QM B1551: BMQ_2415Help
Entry
BMQ_2415          CDS       T01208                                 

Definition
(GenBank) putative gluconolactonase
Organism
bmq  Bacillus megaterium QM B1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL DUF5128 DUF5074
Motif
Other DBs
NCBI-ProteinID: ADE69438
UniProt: D5DSK5
Position
2413573..2414430
Genome map
AA seq 285 aa AA seqDB search
MEAKIEKKYDGRLLEGPLWDEENQKLVLVDILDKKLLTYDPKTTTLEDITLPSVVTSVSK
TNHSKLIVSTHNQLLLVDKNKKNHEEYIRLDTLEKTMRFNDGKCDPYNRFWIGTMSEEGE
EGKAQLYVVDEKGVIKSAKEGLSVSNGLAWNRTGDKFFLVDSPKNKIMSYSFSKETTRLE
DEKVVIDLSDMDGFPDGMTIDEHDRLWVALWGGSKVICVDPDKGEIIESIHLPVSNVTCC
TFGGDDLQTLFITTAKEEEKYEEAAGSLFSCRVGVKGVPAYTYVY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaaattgaaaaaaagtacgatggccgtttgcttgaaggacccctatgggat
gaagaaaatcaaaaattagtactagtagacatcttagataaaaagcttcttacgtacgat
ccaaaaacgacaaccttagaagatattactcttccttcagtcgttacaagcgtttctaaa
accaatcattcaaaattgattgtctccacccataatcagctgcttttagttgataaaaac
aaaaagaatcatgaagagtatatccgtttagatactcttgaaaaaaccatgcgttttaat
gacgggaaatgtgatccatataatcgcttttggattggaacgatgagtgaagaaggtgaa
gaaggaaaagcccagctgtacgtagtagatgaaaaaggtgtaattaagagtgctaaagaa
ggattaagcgtgtcaaacgggctagcttggaatcgaacaggagacaaattctttctagtc
gattcaccgaaaaataaaattatgtcttattcattttcgaaagaaacaacaaggctcgaa
gatgaaaaagtggtgattgacctttcagatatggacgggtttcctgatggaatgacaatt
gatgaacacgaccgattatgggtagcgctttggggaggttccaaagttatttgtgtagat
ccagataaaggagaaattatagaatctattcatcttcctgtttccaatgtaacctgctgt
acatttggaggagacgatttacaaaccttatttatcaccacagctaaggaagaagaaaaa
tacgaagaagctgccggctctcttttttcatgccgagtaggagtaaaaggcgtgccggct
tatacttacgtatattag

DBGET integrated database retrieval system