KEGG   Bacillus megaterium QM B1551: BMQ_2497Help
Entry
BMQ_2497          CDS       T01208                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00071  Fatty acid degradation
bmq00072  Synthesis and degradation of ketone bodies
bmq00280  Valine, leucine and isoleucine degradation
bmq00310  Lysine degradation
bmq00362  Benzoate degradation
bmq00380  Tryptophan metabolism
bmq00620  Pyruvate metabolism
bmq00630  Glyoxylate and dicarboxylate metabolism
bmq00640  Propanoate metabolism
bmq00650  Butanoate metabolism
bmq00900  Terpenoid backbone biosynthesis
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
bmq01212  Fatty acid metabolism
bmq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMQ_2497
   00630 Glyoxylate and dicarboxylate metabolism
    BMQ_2497
   00640 Propanoate metabolism
    BMQ_2497
   00650 Butanoate metabolism
    BMQ_2497
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMQ_2497
   00072 Synthesis and degradation of ketone bodies
    BMQ_2497
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMQ_2497
   00310 Lysine degradation
    BMQ_2497
   00380 Tryptophan metabolism
    BMQ_2497
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMQ_2497
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMQ_2497
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMQ_2497
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmq04147]
    BMQ_2497
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMQ_2497
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMQ_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADE69519
UniProt: D5DST6
Position
2491690..2492790
Genome map
AA seq 366 aa AA seqDB search
MTIYQAAVVKAKRTVIGKENGALKNFRVQELAAPLLKQLSAGIEHEIDDIILGNVVGPGG
NVARLSALEAELPFSIPGMTIDRQCGAGLEAIRMASYLIKAGAGTCYLAGGVESTSTSPF
EKRARFSPDKIGDPDMGIAAENVAQQYNISKDQQDRYALLSHERSWESFEKRLFEEETLP
LSNVMHDEAFMKNRNLTKLLQKASPVFLKKDGTVTAANSCGINDGACVTLVMEEQKARAL
GFQPVLRFIDADISGVSPLYPAIAPVSAIKNILKRNSLTIDDIDLFEINEAFAVKVVACM
QELGISEEKVNIRGGALTLGHPYGASGAILATRLFYESKRRDVRYVIAALGSGGGIGTAV
LFEVIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactatctaccaggcagcagttgtaaaagcgaagcgtacagtgattggaaaagaaaac
ggcgcacttaaaaattttcgcgttcaagagctagcggctcctttattaaaacagcttagc
gctggaatcgagcatgaaattgatgacattattttaggcaatgttgtaggtccaggagga
aatgtagctagactatccgccttagaagcagagctccctttttctatcccgggaatgacc
attgatcgtcagtgcggagcgggcttagaggctattcgaatggccagctatttgataaaa
gctggcgctggaacgtgttatttagctggaggagttgaaagtacaagtacttctcctttt
gaaaaaagagcacgtttttctcctgataaaattggtgaccctgacatggggatcgcagca
gaaaacgtagcccagcaatacaatatatctaaagaccagcaggataggtatgctctttta
agccatgaaagaagctgggagtcttttgaaaagagattgtttgaagaagaaacgcttcct
ctttcaaatgtgatgcatgatgaagcgtttatgaaaaaccgaaacctaacaaagctgctt
caaaaagccagccccgtctttttaaaaaaagacggtaccgtcactgcagccaacagctgt
ggaattaatgacggggcctgcgttacacttgtgatggaagagcaaaaagcacgcgcctta
ggatttcagcccgttttacgttttatagacgctgatatttcaggcgtgtcgcctctatac
cctgctattgcgcccgtttctgcgattaaaaatatcttgaagcgaaattctcttacgata
gatgacattgacttatttgaaatcaatgaagcctttgccgttaaagttgttgcttgtatg
caagaactggggatatcagaagagaaagtaaatattcgcggaggagcgttgacgctggga
cacccatacggagcatcaggagctattttagccacgcgtcttttttatgaaagcaagcgc
cgtgacgtgcgatatgtaatagctgctttagggagcggaggcggaataggaacagcggta
ttatttgaagtaatcaaataa

DBGET integrated database retrieval system