KEGG   Priestia megaterium QM B1551: BMQ_2670
Entry
BMQ_2670          CDS       T01208                                 
Symbol
glpQ
Name
(GenBank) glycerophosphodiester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
bmq  Priestia megaterium QM B1551
Pathway
bmq00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMQ_2670 (glpQ)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     BMQ_2670 (glpQ)
SSDB
Motif
Pfam: GDPD PI-PLC-X
Other DBs
NCBI-ProteinID: ADE69692
UniProt: D5DU30
Position
2658008..2658880
AA seq 290 aa
MKKYLAGLSAVALLCCSIASSAFARTEEKLTNIAHRGASAYAPENTMAAFHQALEMNADY
IELDVQQSKDGVLVIMHDRTVDRTTNGSGHVRELTYAELQRLDAGSWKDNSFMNEKIPTL
SQVLDEFQGKIGILIELKAPELYPGIERKVAFEINKRQLDHIIIQSFNVSSMKKMHELLP
NVPIGILTSSERDANPNSIQQLAAFATYFNPSYDILTPTLIHQVHSAGMKISPWSGSKRL
PASFLWKTKSDGVITNYPDEVNWVQISTKIGKTIHASSASHTARLVGVKK
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaaaaatatttagctggtctaagcgccgtcgccttgttatgctgttcaatcgcctct
tctgcttttgcacgcacggaagaaaaacttacgaacattgcgcaccgaggagcttctgct
tacgcacctgaaaatacaatggctgcttttcaccaagcgctagaaatgaatgcggattac
attgaacttgacgtgcagcaaagcaaagacggtgtactcgttattatgcatgaccgtacc
gtagaccgaacgacaaacggaagcgggcacgttcgagaattaacgtacgctgagcttcag
cgcttggatgcaggaagctggaaagacaattcttttatgaatgaaaaaattccaactctt
tcacaagtattagatgaatttcaaggaaaaatcggtatattgatagagttaaaagctccg
gaactttatcctggaattgaaagaaaagtagcttttgaaatcaacaagcgacagctcgat
cacattatcattcagtcttttaacgtttcatccatgaaaaaaatgcatgagcttctccca
aatgttcctataggcatactaacttcttcagaacgagatgcaaacccaaactcaattcag
caattagccgcttttgccacttactttaacccgtcctatgacatcctaacgcctactctc
atccaccaagtccattctgccggaatgaaaatatcaccgtggtctggaagcaagcggctt
cccgcttcatttttgtggaaaacaaaaagtgacggagtgattacgaattatccggatgaa
gtgaattgggtgcaaatatcaacaaaaatagggaaaaccattcacgcaagctccgcgagc
cacactgctcgcttagttggtgtaaaaaagtaa

DBGET integrated database retrieval system