KEGG   Bacillus megaterium QM B1551: BMQ_2896Help
Entry
BMQ_2896          CDS       T01208                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component (dihydrolipoamide succinyltransferase)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00020  Citrate cycle (TCA cycle)
bmq00310  Lysine degradation
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_2896 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMQ_2896 (odhB)
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMQ_2896 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N WDCP
Motif
Other DBs
NCBI-ProteinID: ADE69918
UniProt: D5DV51
Position
complement(2876570..2877865)
Genome map
AA seq 431 aa AA seqDB search
MGEIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLA
GEGDTVQVGETIARLEAKEGASAPAAPKAEEKPAEEAPKQEAAPAQQKTVEEVAPAAEAP
QQGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSYADQKSNEQKQQAQA
SKPATPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA
LRKRRKDKFFEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIAVSA
PDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLSLKDLQGGTFTITNGGVFGSLMST
PILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggagagattaaagtaccggaattagcagaatcaatttctgaaggaacagttgcacag
tggctaaaacaagtaggagatttcgttgaaaaaggcgattatatcgttgaacttgaaaca
gataaagttaacgttgaaattacagctgaagactctggtgtattaacggaacttcttgct
ggcgaaggcgacacagtgcaagttggtgaaacaattgcacgtcttgaagcgaaagaagga
gcttcagcaccagcagcaccaaaagctgaagaaaaaccagcagaggaagcaccaaagcaa
gaagcggctccagctcagcaaaaaactgttgaagaagtagcgccagcagctgaagcgcct
cagcaaggaaatcaaaaacaatggctaattgcttctcctgcagctcgtaaagcagcaaga
gaacgcgggattaagctagatcaagtgccaactactgatcctcttggccgtgtgcgcaaa
catgatattgattcgtatgcagaccaaaaatcaaatgagcaaaagcagcaggcacaagca
agtaagccagctaccccggtatctccgtctccagcggcaagtgaaaatagcgacaaacct
gttgaacgcgaacgtatgtcacgtcgtcgtcaaacaattgccaaacgtcttgttgaagtt
cagcaaacagcggctatgctaacaacgtttaacgaagtagacatgactgctgttatggct
cttcgcaaacgacgcaaagacaaattctttgaacagcacgacgtaagacttggctttatg
tcattctttacaaaagcagtagtagcagcacttaaaaagtatccattattaaatgctgaa
attcaaggaaacgagttattaattaaaaaattctatgatatcggtattgctgtgtcagct
ccagacggtcttgttgttccagttgtacgtgatgctgaccgcaaaacattcgctggtatc
gaaggatctatcgttgatttagcgaaaaaagcgcgcgacaacaaattatcattaaaagat
ttacaaggtggaacgttcacaattacaaacggcggcgtattcggttcattaatgtctaca
ccaattttaaacggacctcaagttggtattttaggaatgcacaaagttcagcttcgtccg
gtagcaattgatgaagagcgtatcgaaaatcgtccgatgatgtacattgcactttcttac
gatcaccgtatcgttgacggcaaagaagccgtaagcttcctagctactgttaaagaacta
ttagaagatccagaatctttattactagaaggttaa

DBGET integrated database retrieval system