KEGG   Bacillus megaterium QM B1551: BMQ_3396Help
Entry
BMQ_3396          CDS       T01208                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00030  Pentose phosphate pathway
bmq00051  Fructose and mannose metabolism
bmq00680  Methane metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_3396 (fbp)
   00030 Pentose phosphate pathway
    BMQ_3396 (fbp)
   00051 Fructose and mannose metabolism
    BMQ_3396 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BMQ_3396 (fbp)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BMQ_3396 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADE70418
UniProt: D5DZL7
Position
complement(3304635..3306563)
Genome map
AA seq 642 aa AA seqDB search
MNTKYLDLLAQKYDTEEKVVTEIINLEAILHLPKGTEHFVSDLHGEYQAFQHVLRNGSGN
VKEKIKDLFKNVLSDKEINEFATLVYYPEEKLPLIKAQFRNKKELYQWYTEIIDRMLNLI
SYASSKYTRSKLRKALPNQFVYIIEELLYKTDEFTNKEQYYTKIVQQIISLGQADKLIVG
LAYTTQRLVVDHLHVVGDIYDRGPEPDKIMDTLINYHSVDIQWGNHDVLWLGAFAGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKVSSSDKLSDHERLQI
TKIHQAIAMIQFKLESPIIKRRPFFNMSERLLLEKIDYDKNEITIYGNTYPLENSCFATV
NPAQPDQLLEEEEQVMERLLLSVQHSEKLARHMKFLMKKGNLYLKYNGNLLIHGCIPLDE
EGNMEKMTIEDKTYAGRNLLDVFEHYLQEAFAHPEETDDLATDMVWYLWTGEYSSLFGKR
AMTTFERYFISDKTTHKEKKNPYYYLRENEEVCRNILEEFNLNPDHGHIINGHTPVKEIE
GENPVKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKEEILLEGTD
VLSVKRLVDKELERKMVLETNVGEELLKEISILKDLRKYRYS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacaaaatatctagatttacttgcacaaaagtatgatacggaagaaaaagtggta
accgaaattattaaccttgaagctattcttcatctgccaaaagggaccgagcattttgtc
agcgatttacacggcgagtatcaagcctttcagcacgtgctgcgaaacggttcggggaat
gtaaaagagaaaattaaagatctttttaaaaacgtattatctgacaaagaaatcaatgaa
tttgcgacattagtctattaccctgaagaaaaattaccgttgatcaaagcacagtttcga
aacaaaaaggaactctatcaatggtatacagaaatcattgatcgtatgcttaatcttatt
tcgtacgcttcttctaaatacacgcgttctaaactgcgtaaagcattgccaaatcaattt
gtgtacattattgaagaactgctatataaaacggatgaatttacaaataaagagcagtac
tacacgaagattgttcagcagattatctctttaggacaggctgataagcttatcgtaggc
cttgcttatacaacacaaaggttggttgttgaccatctgcacgtagtaggggatatttat
gaccgtggacctgaaccggataaaattatggatacgctgattaactatcactccgttgat
attcagtggggaaatcacgatgtgctatggctaggcgcttttgcgggttcgaaagtgtgt
cttgccaatattattcgtatctgcgcaagatacgacaatctagatattattgaagatgta
tatggcattaacttgagaccgttgcttaacctggcggagaaatactatgatgataatcct
gcttttagaccaaaagtaagctcgagtgacaaactatccgatcacgagcgactacaaatt
acgaaaattcatcaggccattgcgatgattcaattcaagcttgaaagtccgattataaaa
agacgtcctttctttaatatgtcggaaaggctgttgcttgaaaaaattgattatgataaa
aatgaaattacgatatacggaaacacgtatccgctagaaaacagctgctttgcaacggtt
aatccggcgcagcctgatcagctattagaagaagaagagcaggtaatggaaagactgctg
ctttctgtgcagcattcggaaaagctggcgagacatatgaagtttcttatgaaaaaaggc
aacctttatttgaaatacaacggaaacttattaatacacggctgcattcctttagatgaa
gaaggaaacatggaaaaaatgacgattgaagataaaacgtatgcaggccgcaacttgctt
gatgtgtttgaacattatttacaagaggcttttgcacatcctgaagaaacggatgatttg
gcaacagatatggtctggtacctatggacaggagaatattcatcactctttgggaaacgt
gcaatgaccacgtttgaaagatattttatcagtgataaaacaacgcataaagagaagaag
aatccgtattattacttacgggaaaatgaggaagtctgccgaaacatcctggaagaattt
aatctaaatcctgatcatggtcatattattaatggtcatacgccagtcaaagaaattgaa
ggagaaaacccggtcaaagcaaatggaaagatgattgtcattgacggcggtttttcaaaa
gcgtatcagtccacaacaggaattgctggctacactttattatataattcttacggcatg
cagctagtcgctcacaaacacttcaattcaaaagaagagattttattagaaggaacggac
gtcttatccgtaaagcgattggttgataaagaactagaaagaaaaatggttttagaaaca
aacgtcggagaagaattgttaaaagaaatttctattttaaaagatttaagaaaatatcgc
tatagttaa

DBGET integrated database retrieval system