KEGG   Bacillus megaterium QM B1551: BMQ_4980Help
Entry
BMQ_4980          CDS       T01208                                 

Gene name
yutF
Definition
(GenBank) 4-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00627  Aminobenzoate degradation
bmq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMQ_4980 (yutF)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BMQ_4980 (yutF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: ADE71959
UniProt: D5DV87
Position
complement(4785897..4786667)
Genome map
AA seq 256 aa AA seqDB search
MKEYKGYLIDLDGTMYKGTELIAEARDFVIKLKEKGIPYLFVTNNSTKTPDKVAEKLEAF
GIPATEEQVFTTSQATANYLHERKANASAYVIGGEGIRHALLEKGFTIEEEDTDFVVVGL
DQEITYEKLAKACLNVRNGAFFVSTNGDIAIPTERGLLPGNGSITSVITVSTQTNPVFIG
KPESIIMEQALEVIGTPKEETIMIGDYYDTDILAGMNAGLDTLLVHTGVTTRELLEGYEK
KPTYTVDSLKEWMERI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatataaaggatatttgattgatttagacggaacaatgtacaaaggaacagag
ctaattgccgaggcgcgtgattttgttattaaattaaaggaaaaaggaattccttattta
tttgtaacaaacaactctacaaaaacgcccgataaagtagctgaaaagctagaggcattt
ggcattcctgcaacagaagagcaagtttttacaacgagccaggcaacagctaattattta
cacgaacgcaaagcaaacgcttcagcttatgtaattggtggagaaggaatccgacatgcg
ctgcttgaaaaaggatttaccattgaagaggaagatacggatttcgtagttgttggtttg
gatcaggaaattacatatgaaaaattagcaaaagcatgtttaaacgttcgaaacggcgcc
ttttttgtttcaacgaacggagatattgcgattcctactgaaagaggcttactgcctggt
aatggatctatcacgtccgttattacggtttctactcaaacaaatccagtatttattggc
aaaccagaaagtattattatggagcaagcccttgaagtcatcggtacgccaaaagaagaa
acaatcatgattggtgattactatgatacagatattttagcagggatgaatgcaggctta
gatacattattagtccatacaggggtaacaacaagagagttactagaaggatatgagaaa
aagccaacttatacggtagattcactaaaagagtggatggagagaatttaa

DBGET integrated database retrieval system