KEGG   Bacillus megaterium QM B1551: BMQ_5211Help
Entry
BMQ_5211          CDS       T01208                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00030  Pentose phosphate pathway
bmq00480  Glutathione metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmq_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMQ_5211 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMQ_5211 (gnd)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BMQ_5211 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BMQ_5211 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored 3HCDH_N 2-Hacid_dh_C Shikimate_DH ApbA NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: ADE72188
UniProt: D5DWM3
Position
complement(5015867..5017279)
Genome map
AA seq 470 aa AA seqDB search
MAKQQIGVIGLAVMGKNLALNIESRGYSVSVYNRSPEKTEEFLKTEAEGKNFAGTYSVEE
FINSLEKPRKILLMVKAGAATDATIDSLKPYLEKGDILIDGGNTFFQDTIRRNKELEELG
IHFIGTGVSGGEEGALKGPSIMPGGQKEAYELVKPILTAISAKVEGDDCCTYIGPNGAGH
YVKMVHNGIEYGDMQLICEAYFIMKNVLGLETDELHEVFAEWNKGELDSYLIEITADIFT
KKDEETGKALVDVILDTAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVKA
SKVLSGPNAAAFEGDKTELVEAIRKALYMSKICSYAQGFAQMKAASEEYDWNLQYGDIAM
IFRGGCIIRAQFLQKIKEAYDRDADLTNLLLDPYFKDIVEGYQSALREVISIAVKQGIPV
PSFSSALAYYDSYRTETLPANLLQAQRDYFGAHTYQRVDKEGVFHTEWLK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaacaaatcggtgttatcggtttagcggttatggggaaaaacttggcgcta
aacattgagagcagaggctattctgtttcagtttataaccgctctcctgaaaagacagaa
gagttcctaaaaacagaagcagaaggtaaaaattttgcaggtacatacagtgtggaagag
tttattaattctcttgaaaaaccgcgtaaaattttattaatggttaaagctggtgctgct
acagatgcaacaattgattcgttaaaaccatacttagaaaaaggcgacattttaatcgat
ggcggaaatacattcttccaggatacaattcgtcgtaacaaagagctagaagaattaggt
atccatttcatcggtacaggcgtatccggcggagaagaaggggcattaaaaggaccttca
atcatgcctggcggacaaaaagaagcatatgaacttgtaaaaccaatcttaacagctatt
tcagcgaaagttgaaggcgatgattgctgcacatacattggaccaaatggtgcaggtcac
tacgtaaaaatggttcataacggcatcgagtacggcgatatgcagttaatttgtgaagca
tacttcattatgaaaaacgtattaggtttagaaacagatgaactacatgaagtatttgct
gaatggaataaaggcgagctagatagctacttaattgaaatcacagctgatatctttacg
aaaaaagatgaagaaacaggtaaagcacttgtagacgttattttagacactgcaggtcaa
aagggtacaggtaaatggacaagccaaagtgcgcttgatttaggtgtaccactaccaatc
attacggaatctgtatttgcgcgctttatttcagctatgaaagaagaacgtgtaaaagca
agcaaagtattgagcggtccaaatgcagctgcatttgaaggtgataaaaccgaattagta
gaagcaatccgtaaagcattgtacatgagtaaaatttgttcatatgcgcaagggtttgct
caaatgaaagcagcttctgaagaatatgactggaatttacagtacggtgatattgcaatg
atcttccgtggtggttgtatcatccgtgcacaattcttacaaaaaattaaagaagcttac
gatcgcgatgcagatctaacaaacttattattagacccatacttcaaggatatcgtagaa
ggctatcagtcggctcttcgtgaagttatttcaattgcggttaaacaaggtattcctgta
ccaagtttctcaagtgcattagcttactatgacagctaccgtacagaaacgttaccagcg
aaccttttacaagcgcaacgtgactacttcggagctcacacatatcaacgtgttgataaa
gagggcgtattccatactgagtggttaaaataa

DBGET integrated database retrieval system