KEGG   Brucella microti: BMI_I1907Help
Entry
BMI_I1907         CDS       T00955                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthetase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bmr  Brucella microti
Pathway
bmr00860  Porphyrin and chlorophyll metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMI_I1907 (hemD)
Enzymes [BR:bmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BMI_I1907 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACU48849
UniProt: C7LEB4
Position
1:complement(1829652..1830359)
Genome map
AA seq 235 aa AA seqDB search
MKRVLVTRPEPAAAQTAAKLRAAGYEPVLLPLSRTVALSFTVPDEVFDALTITSANAFRH
IAPERLLPYRTLPLFAVGEGTAKAAQEAGFKHVIEGGGDAVRLAGTMRQALAPTARVLYL
AGRVRQPVFEDEVAANGLSMMVCDVYDTESVMYPPQALSRILGHAPFIAVMLYSGVAAAS
FVEAMRSITPPFDEKTRFLCISARVAAKLPSSWLQQALVSDHPDEKGLFRLFSKL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggttcttgttacacggcctgagccggcagcagcgcaaaccgcagcaaagctt
cgcgcggcgggctatgagccagtgcttctgccgttgagccgcaccgtggcgctttccttt
accgttcccgatgaagttttcgacgcgctcaccattacgagcgccaatgcctttcgccat
attgcgccggagcggcttttgccctaccgcacgctgccgctttttgctgtgggtgagggg
acagcgaaggctgcgcaggaggccggttttaaacatgtgatcgagggtgggggcgatgcc
gttcgccttgccgggaccatgcggcaggcgctggcgccaactgcgcgcgtcctttatctt
gccgggcgggttcgccagccggtttttgaagatgaggtggcggcaaatggtctttcaatg
atggtttgcgatgtctacgacactgagtcggtcatgtatccgccgcaggcgctttcccgc
attctcggccatgcgccatttatcgcggtgatgctttattcaggcgtggcggcggccagt
tttgtcgaagcgatgcgctccattacgccgccattcgatgagaagacgcggtttttatgc
atttcggcgcgggttgcggccaaattgccttccagttggctgcaacaggcgctggtttcg
gatcatccagatgaaaaggggcttttccgcttgttttctaaactttga

DBGET integrated database retrieval system