KEGG   Brucella microti: BMI_I1948Help
Entry
BMI_I1948         CDS       T00955                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmr  Brucella microti
Pathway
bmr00020  Citrate cycle (TCA cycle)
bmr00640  Propanoate metabolism
bmr00660  C5-Branched dibasic acid metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
bmr01130  Biosynthesis of antibiotics
bmr01200  Carbon metabolism
Module
bmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMI_I1948 (sucC)
   00640 Propanoate metabolism
    BMI_I1948 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BMI_I1948 (sucC)
Enzymes [BR:bmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMI_I1948 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A FmiP_Thoc5
Motif
Other DBs
NCBI-ProteinID: ACU48890
UniProt: C7LEF5
Position
1:complement(1868137..1869333)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTLPGPLYVVKSQIHAGGRGKGKFK
ELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYL
SILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLE
GGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFRHPDIV
ELRDLTEEDPKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVEGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaagcgcctgcttcacacctacggcgcgccgatcgcc
aatggtgtggctgtctattccgtcgaacaggcggaagaatgggcaaagacgcttcccgga
ccgctttatgtcgtcaagagccagatccatgctggcggacgcggcaagggcaagttcaag
gaactgcctgccgatgcaaagggcggcgtgcgcctcgccaagtctgtcgaggaagtggtt
gccaatgcgaaggaaatgctgggcaacacgctcgtcaccaagcagaccggcgaagccggc
aagcaggtcaaccgtctctacattgaagatggcgccgatatcgagcgtgagctttatctc
tccatcctgatcgaccgcagcgttggccgtccggcctttgtcgtttcgaccgaaggcggc
atggatattgaagccgttgccgaagaaacccctgaaaagatcgtcaccgtcgccatcgac
ccggccaagggcgtgaccgacgaagatgccaacaagcttgccgatgcgctgaagcttgaa
ggtggagcccgcgaggacggcctgaagctgttcccgatcctttacaaggctttcaccgag
aaggacatgagcctcctcgaaatcaatccgctgatcgtcatgacgaacggtcgcgtgcgc
gttctcgatgccaaggtttcgttcgacaacaacgccctgttccgtcacccggacattgtt
gaactgcgcgacctgacggaagaagatccgaaggaaatcgaagcctccaaatatgacctg
gcctatgtcgccctcgatggcaatatcggctgcatggtcaatggcgccggccttgccatg
gcgacgatggacatcatcaagctctatggcgcagaacctgccaacttcctcgatgttggc
ggcggcgcttccaaggagaaggtgacggctgcgttcaagatcatcaccgccgatccggct
gtcgaaggcattctggtcaacattttcggcggcatcatgaagtgcgatgtcattgccgaa
ggcgtgatcgccgcggtcaaggaagtcggcctcaaggttccgctggttgtccgtctcgaa
ggcaccaatgtcgagcttggcaagaagatcatcaacgagagcggcctgaacgtcatttcg
gccgacgatctcgacgatgcggcgcagaagatcgtcgctgcagtgaaggggaattaa

DBGET integrated database retrieval system