KEGG   Brucella microti: BMI_I849Help
Entry
BMI_I849          CDS       T00955                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmr  Brucella microti
Pathway
bmr00010  Glycolysis / Gluconeogenesis
bmr00071  Fatty acid degradation
bmr00350  Tyrosine metabolism
bmr00625  Chloroalkane and chloroalkene degradation
bmr00626  Naphthalene degradation
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
bmr01130  Biosynthesis of antibiotics
bmr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMI_I849
  Lipid metabolism
   00071 Fatty acid degradation
    BMI_I849
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMI_I849
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMI_I849
   00626 Naphthalene degradation
    BMI_I849
Enzymes [BR:bmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMI_I849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP adh_short TrkA_N NADH_4Fe-4S MAF_flag10 Limkain-b1 CMAS
Motif
Other DBs
NCBI-ProteinID: ACU47839
UniProt: C7LBF4
Position
1:complement(829965..830993)
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRRLEITDIAPPPLPGMGEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVDAVGPGVSNLLPGQLVSIYGARTCGLCRACREGRDNLCEHVGGVHGFHLDGFA
CEAVNLPARLLVAAPPGVDAIGAAVAPVTFGTVEHMLFDNAKLEPGETVLVQAGGSGIGT
AAIQLAKKMGCTVITTVGSNDKIEKAKALGADHVINYREDRFEGVVRKLTKKKGVDVVFE
HVGADTWAGSMLCMKRGARLVTCGSTSGVSTNMNLMQLFQQQLKIFGSFGCRMENMADAM
QKMARGIVHPVIDTVVGFSDIDTALKRMEGRDVFGKIILQID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttgcagcttctcgatgatcgccgccttgaaatcaccgatattgcgcccccg
ccgctgcccggcatgggggaagtgaccgttcgcatcaaggccgtggcgctcaaccatatc
gatgtctggggctggcgcggcatggcctttgccaagcgcaagatgccgctcgtcatcggt
gcagaggcttccggtgttgtcgatgctgtcggtcccggcgtttccaatctcctgcccggc
cagctcgtttccatctatggcgcgcgcacctgcgggctttgccgcgcctgccgcgaaggc
cgtgacaatctttgcgaacatgtgggcggcgtgcatggtttccatcttgatggctttgcc
tgcgaagcggtgaaccttcccgcccgcctgctggttgccgcccctcccggcgtggatgct
atcggcgcggctgttgctccggtcacattcggcacggtggaacatatgctgttcgacaat
gccaagcttgaacccggcgaaaccgtgctcgttcaggctggcggctcaggcattggcacg
gctgcgatccagcttgcaaagaagatgggctgcacagtcatcaccacagtcggctccaac
gacaagatcgagaaggccaaggctcttggcgccgatcacgtcatcaattaccgcgaggac
cgtttcgagggcgtggtgcgcaagctcaccaagaagaagggcgtggatgtggtgttcgag
catgtgggcgcggacacatgggcaggctccatgctgtgcatgaagcgcggcgcgcgtctc
gtcacctgcggctcgacctcgggcgtttccacgaacatgaacctgatgcagcttttccag
cagcagttgaagattttcggctccttcggctgccgcatggaaaacatggccgacgccatg
cagaagatggcacgcggcatcgtgcatccggtcatcgacaccgtggttggctttagcgat
atcgacacggcgctgaagcgcatggaaggccgcgacgtcttcggcaagatcattctccag
atcgactga

DBGET integrated database retrieval system