KEGG   Brucella microti: BMI_I883Help
Entry
BMI_I883          CDS       T00955                                 

Gene name
surE
Definition
(GenBank) acid phosphatase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
bmr  Brucella microti
Pathway
bmr00230  Purine metabolism
bmr00240  Pyrimidine metabolism
bmr00760  Nicotinate and nicotinamide metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMI_I883 (surE)
   00240 Pyrimidine metabolism
    BMI_I883 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BMI_I883 (surE)
Enzymes [BR:bmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BMI_I883 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE preATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACU47872
UniProt: C7LBI7
Position
1:863317..864084
Genome map
AA seq 255 aa AA seqDB search
MRILLTNDDGIHAEGLAVLERIARKLSDDVWVVAPETDQSGLAHSLTLSEPLRLRQIDAR
HFALRGTPTDCVIMGVRHVLPGAPDLVLSGVNSGANMADDVTYSGTVAGAMEGTLLGVRA
IALSQEYEYAGDRRIVPWETAEAHAPELIGRLMEAGWPEGVLLNLNFPNCAPEEVKGVRV
TAQGKLSHDARLDERRDGRGFPYFWLHFGRGKAPVADDSDIAAIRSGCISVTPLHLDLTA
HKVRAELGAALGVEA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtattctgctgacgaacgatgacggtatccacgctgaaggcctcgctgttctggag
cgaattgcacgcaagctctccgacgatgtgtgggtggtggcccctgaaacggaccagagc
gggcttgcccactcactgacactgtcggagccgcttcgccttcgccagatcgatgcccgt
cattttgccctgcgcggcactccgaccgattgcgtcatcatgggggtgcgccatgtattg
ccgggcgcgcccgatctcgtcctctccggcgtcaattccggggcgaacatggccgacgat
gtgacctattcgggcacggttgccggtgcgatggaggggacattgcttggtgtgcgagcc
atcgctttgtcgcaggaatatgaatatgcgggcgatcgccggatcgtgccgtgggaaacg
gcggaagctcatgcgcctgagcttatcgggaggctgatggaggcgggctggccggaaggc
gtgctgttgaacctcaatttcccgaattgcgctccggaagaagtgaagggcgtgcgcgtc
acggcacaaggcaagcttagccatgatgcgcgccttgacgagcgccgcgatggacgtggt
ttcccttatttctggctgcatttcggtcgcggcaaggctccggttgccgacgacagcgat
attgctgccatccgttcgggttgcatttcagtgaccccactccaccttgatctgaccgct
cataaggttcgtgcagaactgggcgcggcgcttggagtggaagcatga

DBGET integrated database retrieval system