KEGG   Brucella microti: BMI_II606Help
Entry
BMI_II606         CDS       T00955                                 

Definition
(GenBank) response regulator/GGDEF domain protein
  KO
K02488  two-component system, cell cycle response regulator [EC:2.7.7.65]
Organism
bmr  Brucella microti
Pathway
bmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMI_II606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmr02022]
    BMI_II606
Enzymes [BR:bmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     BMI_II606
Two-component system [BR:bmr02022]
 Cell cycle family
  PleC-PleD (cell fate control)
   BMI_II606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF Response_reg GGDEF_2
Motif
Other DBs
NCBI-ProteinID: ACU49734
UniProt: C7LI96
Position
2:complement(598567..599952)
Genome map
AA seq 461 aa AA seqDB search
MTARILVVDDVDSNVKLLEARLLSEYYEVVPAYSGAEAIEICLDGQIDIVLLDVLMPGLD
GFEVCRRLKANPRTANIPVIMITCLTSPEDKVRGLEAGAEDFLSKPVNDLELLSRLKSLT
RLKMMSDELFQRAGRIADAEVDALLARKMAGKDGNKDEIARILVVDEDELAAARLRHILD
ENYRVDVASDAETALIRAIETDYDTIIVSASFTYYDPLKLCTQLRTIQRTRLIPIILMVW
EDEGALVVRALELGVNDYLMRPLEKIELFARLRTQIKRKCYNDILRQSMERTITQSVTDG
LTGLHNRRYIDMHMPLLLTRAIERKQPLSIIMIDLDHFKQVNEQYGHGAGDHVLREFSGR
LRRNIRGMDLISRYGGEEFVVVLPDTDRQAAFNVAERVRGIVAEAPFVLDDGKRRASLTV
SVGVAALRPAGDSLEALFTRATDALIQAKQSGRNRIVLSAA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaggattctcgtcgtcgatgatgtggactccaatgtaaagcttctcgaagcg
cgccttctcagcgaatattacgaagtcgttcccgcctatagcggcgccgaggcgattgaa
atctgtcttgatgggcagatcgacattgttcttctggatgtattgatgccggggcttgat
ggtttcgaggtttgccgacgcctgaaagccaatccgcgtacggcaaatattccagtcatt
atgattacgtgcctcaccagcccggaagacaaggtgcgcgggcttgaggcgggggcggaa
gattttctctcaaagcctgtcaacgatcttgaactcctgtcacggctgaaaagccttacc
cggctcaagatgatgtcggacgagctgttccagcgcgccggccggattgcggatgccgaa
gtggatgccctccttgcgcgcaagatggcgggtaaagacggcaataaagatgagatcgcc
cgcattcttgtggtggatgaggatgaactggcggccgcgcgccttcgccatattctggat
gagaattatcgggtcgatgtggcgagtgacgccgaaaccgcactgatccgcgctattgaa
acagattacgacacgatcatcgtttcggcctccttcacctattatgatccgctgaaacta
tgcacgcaattgcgcacaatccagcgcacgcggctcataccgatcatcctgatggtgtgg
gaagacgagggcgcactggtggtgcgcgcactggaactgggcgtgaacgactatctgatg
cgcccattggagaagatagaactgtttgcgcggctgcgcacacagatcaagcgcaaatgc
tataatgatattctgcgccagagcatggagcgcactattacccaatcggtgacggacggc
ctcacggggctgcataaccgccgctacatcgacatgcacatgccgctgctgctcacacgc
gcaatcgagcgcaagcagcccctctcgatcatcatgatcgatcttgatcacttcaagcag
gtcaacgaacaatatggccatggcgcgggcgatcatgtgttgcgggaattttcgggccgt
ttgcgcaggaatattcgcggcatggatcttatcagccgctacggtggtgaggaatttgtc
gtcgtgctgccggacacggacaggcaggctgccttcaatgtggctgagcgcgtgcggggt
atcgtagccgaagctccctttgtgctcgatgacggaaagcgcagggccagcctgacggtc
agcgtgggcgttgcagcacttcggcccgcaggcgacagccttgaggcgcttttcacccgc
gcgaccgacgcgctcattcaggcgaagcagagcggacgaaatcgcattgttttatccgcg
gcctga

DBGET integrated database retrieval system