KEGG   Brucella microti: BMI_II894Help
Entry
BMI_II894         CDS       T00955                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bmr  Brucella microti
Pathway
bmr00220  Arginine biosynthesis
bmr00330  Arginine and proline metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01130  Biosynthesis of antibiotics
bmr01230  Biosynthesis of amino acids
Module
bmr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BMI_II894 (rocF)
   00330 Arginine and proline metabolism
    BMI_II894 (rocF)
Enzymes [BR:bmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BMI_II894 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACU50008
UniProt: C7LJ20
Position
2:complement(881858..882778)
Genome map
AA seq 306 aa AA seqDB search
MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTDLGNLAPAAQRPLQHPN
HAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGTVPGIARRAAEKGRKQFVL
WLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKLAAPIDPHNVCMLGIRSVDPA
EREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAEDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFLDERGRTAAVMVDLMASLLGRSVMD
RPTISY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtaagattctggggctgcccgttcaggaaggcactggccgcaagggctgtaat
atggggcctgattcctatcgtgcggccgggattgccgatgccataagggaacttgggcac
gagtgcacagatttgggcaatctggcgcctgccgcccagcgcccgctacagcatccgaac
catgcaatcaaggcgcttccatatgccgttgcctggatcgaagcgatcagcgaagcggcc
tatcgcgaaagtgcggaagggttcccgatctttcttggtggcgatcaccttctggcagcg
ggcacggttcccggtattgcgcgccgcgccgctgaaaaggggcgcaagcaattcgtgctc
tggctcgatgcgcatacggatttccatacgctggaaaccacgaccagcggcaatcttcat
ggtacgcccgttgcttattataccggtcagaagggctttgagggctatttccccaagctt
gcagcgccgatcgatccgcataatgtctgcatgttgggcattcgcagcgtcgatccggct
gagcgggaagcggtcaagaaaacagaagttatcgtctatgacatgcggctgatcgacgag
catggtgttgccgccctgctgcgccggtttctggagcgcgtgaaggcggaagacgggctg
ttgcatgtgagccttgatgtcgattttctcgatccctccatcgcgccggccgtgggtacg
acggtgcctggcggcgcgaccttccgtgaggcgcatctcatcatggagatgctgcacgac
agcgggctggtgacgagcctcgatctcgttgaactcaatccctttcttgatgagcgcggc
cgcacggccgccgtcatggtggacctgatggcgagccttctgggccgcagcgtcatggac
cgcccgaccatcagctattga

DBGET integrated database retrieval system