KEGG   Brucella suis 1330: BR0082Help
Entry
BR0082            CDS       T00096                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bms  Brucella suis 1330
Pathway
bms00790  Folate biosynthesis
bms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bms00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BR0082 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bms04147]
    BR0082 (phhB)
Enzymes [BR:bms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BR0082 (phhB)
Exosome [BR:bms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BR0082 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AAN29038
UniProt: P65723
Position
I:complement(87541..87834)
Genome map
AA seq 97 aa AA seqDB search
MARNRLTESEMNEALRALDGWQKVDGREAITRSFKFKDFSTAFGFMAQAALYAEKLDHHP
EWFNAYNRVDVTLATHSENGVTELDIKMARKMNAIAG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaccgattgacggaaagcgaaatgaacgaggcgctcagggcgctggacggc
tggcagaaagttgatgggcgcgaggcaatcactcgcagcttcaaattcaaggatttcagc
accgccttcggtttcatggcgcaggcagcactttacgcagaaaagctcgaccatcacccc
gaatggttcaatgcctataaccgtgtggacgtaacacttgcgacccacagcgaaaacggg
gttacagaactggatatcaagatggcgcgcaagatgaacgcgatcgccggttga

DBGET integrated database retrieval system