KEGG   Brucella suis 1330: BR1388Help
Entry
BR1388            CDS       T00096                                 

Gene name
ilvN
Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bms  Brucella suis 1330
Pathway
bms00290  Valine, leucine and isoleucine biosynthesis
bms00650  Butanoate metabolism
bms00660  C5-Branched dibasic acid metabolism
bms00770  Pantothenate and CoA biosynthesis
bms01100  Metabolic pathways
bms01110  Biosynthesis of secondary metabolites
bms01130  Biosynthesis of antibiotics
bms01210  2-Oxocarboxylic acid metabolism
bms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BR1388 (ilvN)
   00660 C5-Branched dibasic acid metabolism
    BR1388 (ilvN)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BR1388 (ilvN)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BR1388 (ilvN)
Enzymes [BR:bms01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BR1388 (ilvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: AAN30301
Position
I:complement(1342431..1343003)
Genome map
AA seq 190 aa AA seqDB search
MNAQNLASGSAYFIAAETQTPETHTLAVLVDNEPGVLARVIGLFSGRGYNIESLTVSETE
HERHLSRITIVTRGTPHVLDQIRHQLARIVPVHRVVDLSHRAATLGHERPIERELALVKV
AGKGEARAETLRLADAFKAKVVDATTDHFILEITGKSAKIDQFISIMKPLGLVEICRTGV
AAMNRGAEGM
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacaaaacctagcttccggatcggcctatttcattgctgccgaaacccagacg
cccgaaacccacacgcttgcagtcctcgtcgataatgagccgggcgttcttgcccgcgtc
atcggcttgttttccggccgtggctataatatcgagagcctgacggtgtcggaaaccgaa
catgagcgccacctttcgcgcatcaccatcgttacgcgcggcacgccgcatgtgctggac
cagatccgccatcagcttgcgcgcatcgttccggtgcatcgcgtggtggatttgagccac
cgcgccgccacgcttggccatgaacgcccgatcgaacgggagcttgcattggtgaaagtg
gctggaaaaggcgaggcgagggcggaaacgttgcgtctggccgatgccttcaaggctaag
gtggtggatgccacgacggaccatttcattttggagattaccggaaaatcggccaagatc
gaccagttcatctcgattatgaagccgctgggtctggtggaaatctgccgcactggcgtt
gccgccatgaaccgtggtgcggaaggcatgtaa

DBGET integrated database retrieval system