KEGG   Brucella suis 1330: BRA0347Help
Entry
BRA0347           CDS       T00096                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bms  Brucella suis 1330
Pathway
bms00051  Fructose and mannose metabolism
bms00520  Amino sugar and nucleotide sugar metabolism
bms01100  Metabolic pathways
bms01110  Biosynthesis of secondary metabolites
bms01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BRA0347
   00520 Amino sugar and nucleotide sugar metabolism
    BRA0347
Enzymes [BR:bms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BRA0347
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BRA0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 DUF4398
Motif
Other DBs
NCBI-ProteinID: AAN33545
Position
II:complement(326808..328223)
Genome map
AA seq 471 aa AA seqDB search
MSFIPVIISGGSGSRLWPLSRDAHPKPFIKLPDGETLIGKTYARASRLVNAEQILTVTNR
DFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHAAEAYGPDATLLVMPADHL
IEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYIEVQGTDVQRFVEKPDEATAQ
TYVESGRYFWNSGMFCFKALSMIDAMQRYAPQVLAGARAALAQARRGNNGETKTLEIARD
EFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSWAAMADLVTPDENGNRLRGETILED
TTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAHRDKAQEVRSVFNKLRKQGHEAAKLHR
TAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLSLQAHHHRSEHWIVVSGTAKVTNGDREIL
LTTNQSTYIPCGFRHRLENPGILPLVLIEVQSGEYLGEDDIVRYDDVYGRV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcataccggtaattatcagcgggggatcgggttcaaggctttggccgctttcg
cgggatgcacatccaaaaccctttatcaaactgccggatggcgaaacactcatcggcaag
acctatgcgcgcgcttcgcgccttgtaaacgccgaacagatccttacggttacgaaccgc
gattttcttttcctgacgctcgacgcttatgcggcggcaggtgccgcgcagatggaaaac
actttccttctggagccgcttggccgcgacaccgcgcccgcagtggcgcttgccgccctt
catgccgctgaagcctatgggccggatgccacgcttctggtcatgccggccgatcacctg
atcgaggatgaacaagccttcgcggaagcggttgcgaaagcgcgcgcgcttgccgaggca
gggcgcatcgtcaccttcggcattgtgccggatcggcccgagaccggcttcggctatatc
gaagtgcaaggtacggatgttcagcgatttgtcgaaaagccggatgaggccaccgcccag
acctatgtggaaagcggacgctatttctggaattccggcatgttctgcttcaaggcattg
agcatgatcgacgccatgcagcgttacgcaccgcaggtactggcaggcgctagggctgcc
ctcgcccaggcccggcgtggcaataacggcgagaccaaaacccttgaaatcgccagggac
gagtttgccgcaacgcctgccatttccatcgactacgcagtcatggaaaaggcggacaat
atggcctgcgtgcccgtttcctgcggctggtcggatatcggctcatgggcggcgatggcc
gatctcgtgacacccgatgaaaacggcaatcgcctgcgcggagaaactattctggaagat
acgaccaacagtttcgtcctttctgaaacccgtctggtgagccttgtcggtgtgcatgat
cttctcgtggttgacacgccggacgcccttctcgtcgctcatcgcgacaaagcgcaggaa
gtacgcagcgttttcaacaaattgcgcaagcaaggtcatgaagctgcaaagctgcaccgc
acagcccatcgcccatggggcacctataccgtgctggaagagggcgacggcttcaagatc
aaacggatcgaggtaaagccagggcggcgcctcagccttcaggcccatcaccaccgctcc
gaacactggatcgtggtgtccggcacggcaaaggtgacgaatggcgaccgggaaatcctg
ctcaccaccaatcagtcaacctatattccctgcggtttccgccaccggttggaaaatccc
ggtattttgcccctcgtcctgatcgaggtgcagagcggcgaatatctcggtgaagacgac
atcgtgcgctatgacgatgtttacggacgcgtttga

DBGET integrated database retrieval system