KEGG   Brucella suis 1330: BRA0450Help
Entry
BRA0450           CDS       T00096                                 

Definition
(GenBank) acetyl-CoA synthetase, putative
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bms  Brucella suis 1330
Pathway
bms00010  Glycolysis / Gluconeogenesis
bms00620  Pyruvate metabolism
bms00640  Propanoate metabolism
bms00680  Methane metabolism
bms01100  Metabolic pathways
bms01110  Biosynthesis of secondary metabolites
bms01120  Microbial metabolism in diverse environments
bms01130  Biosynthesis of antibiotics
bms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRA0450
   00620 Pyruvate metabolism
    BRA0450
   00640 Propanoate metabolism
    BRA0450
  Energy metabolism
   00680 Methane metabolism
    BRA0450
Enzymes [BR:bms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BRA0450
Lipid biosynthesis proteins [BR:bms01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BRA0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAN33644
Position
II:complement(438066..439736)
Genome map
AA seq 556 aa AA seqDB search
MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCDRYTGENRVALRAISI
DNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTPELVATILGAWRIGAIYQP
LFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPRVATILAPGESLPEGDIDFRA
AVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVPLRALMAFGAYMRDAVGLRSDDI
FWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRL
LMAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHG
LEHPVRQGSAGYAMPGYRVAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSI
SGGYYRTGDTVEFEPDGSISFIGRADDVITSSGYRIGPFDVESALLKHPAVNEAAVVGVP
DPQRTEIVKAFVILAPGFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTLSGKIQ
RFLLRKAEVEKQQQQN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagccctgcttcagcacggctcgaccgctacgatgatgccgttgcgcagttc
gatattgcaaaagccattgcgcttcttgcaggaaatcctgatacgggtatcaatgcctgc
attgaatgctgcgaccgatatacgggcgaaaatcgcgtggcgctgcgcgccatttccatc
gacaatacgttgactgaactcacctttgaagacctgcgcgatatgtccgcgcgggtcggc
aatatgctggccgatgccgggatcagcgcaggcgatgtggttgccggtcttctcccccgc
acgcctgaactcgtcgccaccattctcggcgcctggcgcatcggcgcaatctatcagccg
cttttcaccgccttcggcccaaaagccatcgaacagcgtttcggcaccagtggcgccaaa
ctcgtcgtcaccaacctggccaatcgttccaaattggccgaagtggaaaactgcccccgc
gtcgcaaccattcttgcccccggtgaaagcctgccggaaggcgatatcgactttcgcgca
gccgtggcggcagcatcgaccgaatgcgagcccgtcatgcgcaagggcagcgaccttttc
atgatgatgtccacctccggcacggcgggcctgcccaaaggcgtcccggtgccgctgcgc
gccctgatggctttcggcgcctatatgcgcgatgccgtgggcctgcgcagcgacgatatt
ttctggaatatcgccgatccgggctgggcatatgggctttactatgccgtgacgggtccc
ctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgccgaaaacacctat
gacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgactgccttccgcctg
cttatggccgccgggccggaatctgctgcccgcgtcaagggccgcttgcgcgtggtatcc
agcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcctgtcttggcgcg
ccgatccacgatcattacggccagacggaactgggcatggtggtgaacaaccatcatgga
ttggaacatccggtgcggcagggttcggcgggctatgccatgccgggctacagggttgcg
gttctggatgaagcgggcaaagaagtcggccccaatgaaccgggcgttctggccattgat
atcgacaattcgccgcttctctggttcaccggctattataaaaaggatacgccctccatc
tccggcggatattatcgcaccggcgatacggtggaattcgagccggatgggtctatcagc
ttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatcgggcctttcgat
gtggaaagcgcgcttctgaaacatcctgcggtcaacgaggctgcggtggtcggcgttccc
gatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggcccccggcttcgagggt
acgccggaactggcggaagaactggcgcttcacgtcaagaaacagctttccgcccatgcc
tatccgcggcagatcgactttgtggcggagcttcccaagacgctgagcggaaaaatacag
cgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaattag

DBGET integrated database retrieval system