KEGG   Brucella suis 1330: BRA0794Help
Entry
BRA0794           CDS       T00096                                 

Definition
(GenBank) fatty oxidation complex, beta subunit, putative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bms  Brucella suis 1330
Pathway
bms00071  Fatty acid degradation
bms00072  Synthesis and degradation of ketone bodies
bms00280  Valine, leucine and isoleucine degradation
bms00310  Lysine degradation
bms00362  Benzoate degradation
bms00380  Tryptophan metabolism
bms00620  Pyruvate metabolism
bms00630  Glyoxylate and dicarboxylate metabolism
bms00640  Propanoate metabolism
bms00650  Butanoate metabolism
bms00900  Terpenoid backbone biosynthesis
bms01100  Metabolic pathways
bms01110  Biosynthesis of secondary metabolites
bms01120  Microbial metabolism in diverse environments
bms01130  Biosynthesis of antibiotics
bms01200  Carbon metabolism
bms01212  Fatty acid metabolism
bms02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRA0794
   00630 Glyoxylate and dicarboxylate metabolism
    BRA0794
   00640 Propanoate metabolism
    BRA0794
   00650 Butanoate metabolism
    BRA0794
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRA0794
   00072 Synthesis and degradation of ketone bodies
    BRA0794
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRA0794
   00310 Lysine degradation
    BRA0794
   00380 Tryptophan metabolism
    BRA0794
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRA0794
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRA0794
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRA0794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bms04147]
    BRA0794
Enzymes [BR:bms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRA0794
Exosome [BR:bms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRA0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAN33973
Position
II:complement(777066..778274)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system