KEGG   Brucella suis ATCC 23445: BSUIS_A0469Help
Entry
BSUIS_A0469       CDS       T00638                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00564  Glycerophospholipid metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
Module
bmt_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSUIS_A0469
Enzymes [BR:bmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BSUIS_A0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ABY37557
UniProt: B0CKC7
Position
I:461605..462303
Genome map
AA seq 232 aa AA seqDB search
MSLTDTIRNTFVPIHREGYPFIAGFFVVSLILGWLWDPLFWIGMVLTVWCIYFYRDPERV
TPMDDDLVISPADGKVSFVGLAVPPAELDLGYEPMTRVSVFMNVFSVHINRSPVRGKIDK
VVHRPGKFLNAELDKASTENERNSVLIESPHGKVGVVQIAGLVARRIVCWSNQDDELSVG
ERFGLIRFGSRVDVYLPSDATVRVAVGQTAIAGETVLADYGTERGEPVVRIA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgactgatactatccgcaacactttcgtgccgatccaccgcgaaggctacccg
ttcatagcgggcttttttgtggtgtcgctcattctgggctggctgtgggatccgttgttc
tggatcggcatggtactcaccgtctggtgcatctatttctaccgtgacccggagcgggtg
acgcccatggacgatgatctggtcatcagcccggcagatggcaaggtctcctttgtcggg
cttgccgttccgcccgctgaactcgaccttggctatgagccgatgacccgtgtttcggtt
ttcatgaatgtgttttcggtccatatcaatcgctcgccggtgcgcggcaagatcgacaag
gtcgtgcatcgtccgggcaagttcctcaatgccgaactggacaaggccagcaccgagaat
gagcgcaacagcgtgctgatcgaaagcccgcatggcaaggtcggcgtggtgcagattgcc
gggctggtggcgcggcgcatcgtctgctggtcgaaccaggatgacgaactttccgtgggc
gagcggttcggccttatccgtttcggttcgcgcgtcgatgtctatctgccctccgacgcc
acggtgcgcgtcgcggtcggccagaccgcgattgcgggtgaaaccgttctggctgattat
ggtaccgagcggggcgaacccgtggtacggatcgcataa

DBGET integrated database retrieval system