KEGG   Brucella suis ATCC 23445: BSUIS_A1102Help
Entry
BSUIS_A1102       CDS       T00638                                 

Definition
(GenBank) Acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00020  Citrate cycle (TCA cycle)
bmt00620  Pyruvate metabolism
bmt00650  Butanoate metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt01130  Biosynthesis of antibiotics
bmt01200  Carbon metabolism
Module
bmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSUIS_A1102
   00620 Pyruvate metabolism
    BSUIS_A1102
   00650 Butanoate metabolism
    BSUIS_A1102
Enzymes [BR:bmt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BSUIS_A1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABY38159
UniProt: B0CGK8
Position
I:complement(1046857..1048347)
Genome map
AA seq 496 aa AA seqDB search
MLEARIRNSSLRNKVITAEQAASFIKDGMIVGMSGFTRAGDAKAVPVAMAARAATDPFQI
TLITGASLGHDVDKLLTEAHILSRRMPFQADRTLRSAINRGEVMFIDQHLSETVEQLRSN
QIGPIDCAVVEALAITESGGIIPTTSVGNSASLAILAEKVIVEVNLNQPMALEGLHDIYI
PTKRPSRDPIPIMACDSRIGLPYIPIAPEKIAGIVITQENDSASPVEPADHETVAIAGHL
IEFFKGEVVKGRLDLALNPLQAGIGTIANAVLTGFADSPFHNLRMYSEVLQDSTFDLFDA
GKLDFASGSSITLSPACGERVFNNIDRYRDRLVLRPQEISNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVDGTNMMNGIGGSGDFARNAYISIFVSKSEAKNGAISSVVPMVTHVDHTE
HDVDILVTEQGLADLRGLAPRERAPVIIENCAHPDYRDQLMDYYERACKRGGHTPHLLEE
AFSWHLRRQENGSMRK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagcacgtatccgtaacagttcactgcgaaacaaggttatcactgcggagcaa
gcggcaagctttatcaaggatggcatgattgttggcatgagcggctttacgcgcgcgggc
gatgccaaggccgttccggtcgccatggccgcgcgggcggcaaccgatccattccagatc
accctgattacaggggcctccctcggacatgacgtcgataaactgttgaccgaagcgcat
attctttctcgccgtatgccgtttcaggccgaccgcacattgcgcagcgcgatcaaccgc
ggcgaagtcatgtttatcgaccagcatctttccgaaacagtcgagcaacttcgttccaac
cagatcggccccatcgactgtgccgtggtagaggcattggcgattaccgaaagcggcgga
atcatcccgacgacttcggtcggcaattcggccagcctcgccattcttgccgaaaaggtt
atcgtcgaggtcaatctgaaccagcccatggcgctggaaggcctacacgatatttatata
ccgacgaagcgcccttcccgcgatcctatcccgatcatggcttgcgatagccggatcgga
ctgccctatattcccatcgcgccggaaaaaatcgccggtatcgtcatcacgcaggaaaat
gacagtgcgtcacctgtcgagcccgcagatcacgaaacggttgcgattgccgggcatctg
atcgaattcttcaagggggaagtcgtaaagggtcgtctggatctggcgcttaatccattg
caggcgggcatcggcaccattgccaatgcggttttgaccggctttgcagatagtcctttc
cacaatctgcgcatgtatagcgaggtattgcaggatagcacgttcgatctgttcgatgcg
ggcaagctggattttgcctccggctcatcgatcactctcagccccgcttgcggcgagcgc
gttttcaataatatagaccgctatcgtgacaggcttgtcctgcgcccgcaggaaatcagc
aaccatccggaagtcatccgccgtcttggtattatcggcatcaataccgcactcgaattc
gatatctacggcaacgtcaactcaacccatgttgatggaaccaatatgatgaacggcatt
ggcggttccggcgattttgcgcgcaacgcctatatttcgatcttcgtcagcaagtcggaa
gccaagaatggcgcgatctcctcggtcgtgcccatggtaacacatgtggaccacacggaa
catgacgtggatatcctcgtgacggaacagggacttgccgatttgcgcgggcttgcacca
cgcgagcgagcgcccgttatcattgaaaattgcgcacatcccgattaccgggaccagctc
atggattattacgagcgagcctgcaaacgcggcggccacacgcctcatcttctggaagag
gcattcagttggcacctgcgccgtcaggaaaatggcagtatgcgcaaataa

DBGET integrated database retrieval system