KEGG   Brucella suis ATCC 23445: BSUIS_A1186Help
Entry
BSUIS_A1186       CDS       T00638                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00010  Glycolysis / Gluconeogenesis
bmt00051  Fructose and mannose metabolism
bmt00562  Inositol phosphate metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt01130  Biosynthesis of antibiotics
bmt01200  Carbon metabolism
bmt01230  Biosynthesis of amino acids
Module
bmt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUIS_A1186 (tpiA)
   00051 Fructose and mannose metabolism
    BSUIS_A1186 (tpiA)
   00562 Inositol phosphate metabolism
    BSUIS_A1186 (tpiA)
Enzymes [BR:bmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BSUIS_A1186 (tpiA)
Exosome [BR:bmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BSUIS_A1186 (tpiA)
  Exosomal proteins of bladder cancer cells
   BSUIS_A1186 (tpiA)
  Exosomal proteins of melanoma cells
   BSUIS_A1186 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABY38237
UniProt: B0CGT6
Position
I:complement(1135467..1136231)
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggctatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccgtatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggcgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system