KEGG   Brucella suis ATCC 23445: BSUIS_A1281
Entry
BSUIS_A1281       CDS       T00638                                 

Gene name
rplD
Definition
(GenBank) 50S ribosomal protein L4
  KO
K02926  large subunit ribosomal protein L4
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSUIS_A1281 (rplD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bmt03011]
    BSUIS_A1281 (rplD)
Ribosome [BR:bmt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSUIS_A1281 (rplD)
  Bacteria
    BSUIS_A1281 (rplD)
SSDB
Motif
Pfam: Ribosomal_L4
Other DBs
NCBI-ProteinID: ABY38332
UniProt: B0CH31
Position
I:complement(1219815..1220435)
AA seq 206 aa
MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG
SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS
DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI
NVYDILRRGKLVLSKAAVEALEERFK
NT seq 621 nt   +upstreamnt  +downstreamnt
atggatctcacgattaccactcttgaaggcaaggatgccggcaaggtcaagctgaacgaa
gaaatcttcggcctcgacccgcgtgacgacattcttcagcgcgtcgtgcgctggcagctg
gctcgccgccagcagggctctcacaaggcgcagggccgtggcgacgtaagccgcaccggt
tccaagatgtacaagcagaagggtacgggccgtgctcgtcaccattccgcccgtgcaccg
cagttccgcggcggcggtcaggctcacggaccggttgtccgtaaccacgaccacgatctg
ccgaagaaggttcgcgctcttggcctgcgtcatgccctgtccgccaaggccaaggcatcc
gacctgatcatcatcgatgatctggcctctgccgacgccaagacgaagcagctcgtttcg
cagttcgccaagctcggcctcgaaaatgcacttcttatcggcggtgcggagatcgatgcg
aacttccagcgcgcggcttcgaatatcccgaacatcgatgtgctgccggttcagggcatc
aatgtttacgacatccttcgccgcggcaagctcgttctttccaaggcggctgtcgaagcc
cttgaggagcgtttcaaatga

DBGET integrated database retrieval system