KEGG   Brucella suis ATCC 23445: BSUIS_A1676Help
Entry
BSUIS_A1676       CDS       T00638                                 

Definition
(GenBank) NADP-dependent 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BSUIS_A1676
Enzymes [BR:bmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BSUIS_A1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N T4SS-DNA_transf B12-binding
Motif
Other DBs
NCBI-ProteinID: ABY38701
UniProt: B0CI95
Position
I:1585388..1586155
Genome map
AA seq 255 aa AA seqDB search
MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGG
KAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLF
SLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPM
GIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS
GQVLTVSGGGVQELD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatgagagcccgttccacctgaatgatgctgttgcaatcgtcaccggagcggcg
gcaggtatcggacgggccatcgccggaaccttcgccaaggctggtgcttcggttgtcgta
accgaccttaaaagcgaaggcgctgaagccgttgcagccgcaataaggcaagctggcggc
aaggccatcgggcttgaatgcaacgtaaccgacgagcagcatcgcgaagccgtcatcaaa
gcggccctcgatcagttcggcaaaatcactgttctggtcaacaatgcgggtggaggcggc
cccaagcccttcgatatgccgatgagcgactttgaatgggccttcaagctcaatctcttt
tccctgtttcgcctgtcgcaattggctgccccacacatgcagaaggctggcggcggcgca
attctcaatatttcgtccatggccggagaaaataccaatgtccggatggcctcctatggt
tcgtccaaggcggcggtcaatcacctcacccgcaacattgccttcgatgtcggcccaatg
ggcattcgcgtgaatgccatcgcgcccggcgcgatcaagaccgatgcgctcgcaaccgtt
ctgacgcctgaaatcgaacgcgccatgctcaagcacacgccgcttggccgcctcggcgaa
gcgcaggatatcgccaatgcggcgctgttcctctgttcgcccgccgcagcatggatcagc
ggtcaggttctcacggtttccggcggcggcgtgcaggaactcgactga

DBGET integrated database retrieval system