KEGG   Brucella suis ATCC 23445: BSUIS_B0438Help
Entry
BSUIS_B0438       CDS       T00638                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00521  Streptomycin biosynthesis
bmt00523  Polyketide sugar unit biosynthesis
bmt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSUIS_B0438 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSUIS_B0438 (rfbC)
Enzymes [BR:bmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BSUIS_B0438 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABY39436
UniProt: A9WYC0
Position
II:complement(426370..426894)
Genome map
AA seq 174 aa AA seqDB search
MHFTPLNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRG
LHYQNEPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHG
FQTLTDDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSVISQKDLGWPFL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcactccgctcaacatcaacggcgcatggtccatcgagccggaacggctgaag
gacgagcgcggctggttcgcgcgggtctattgcgaggcggcctttgccgaacggaagctg
gaaacacactttccccagcacagcctttccttctcgcgcgagaagggaaccctgcgcgga
ctgcattatcagaacgagccgcatagcgagacgaaactcgtcacctgcctgcaaggcatc
gtctgggatgtgctggtggatcttcgcccccactcacccacttatcggcggtgggcgggg
gtggaactttcagccgaaaacggtgtgcaactctatataccggaaggctgcgcccacggt
ttccagacgctgacggatgatgtcctcatccgctacatgatctcgaagccctatgcgccc
gatcatgccgccggcatccgctatgacgatccagccctcgacattccatggccggagaag
cccagcgtcatttcgcaaaaagatcttggctggccgtttctttga

DBGET integrated database retrieval system