KEGG   Brucella suis ATCC 23445: BSUIS_B1248Help
Entry
BSUIS_B1248       CDS       T00638                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00071  Fatty acid degradation
bmt00072  Synthesis and degradation of ketone bodies
bmt00280  Valine, leucine and isoleucine degradation
bmt00310  Lysine degradation
bmt00362  Benzoate degradation
bmt00380  Tryptophan metabolism
bmt00620  Pyruvate metabolism
bmt00630  Glyoxylate and dicarboxylate metabolism
bmt00640  Propanoate metabolism
bmt00650  Butanoate metabolism
bmt00900  Terpenoid backbone biosynthesis
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt01130  Biosynthesis of antibiotics
bmt01200  Carbon metabolism
bmt01212  Fatty acid metabolism
bmt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSUIS_B1248
   00630 Glyoxylate and dicarboxylate metabolism
    BSUIS_B1248
   00640 Propanoate metabolism
    BSUIS_B1248
   00650 Butanoate metabolism
    BSUIS_B1248
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSUIS_B1248
   00072 Synthesis and degradation of ketone bodies
    BSUIS_B1248
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSUIS_B1248
   00310 Lysine degradation
    BSUIS_B1248
   00380 Tryptophan metabolism
    BSUIS_B1248
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSUIS_B1248
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSUIS_B1248
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSUIS_B1248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmt04147]
    BSUIS_B1248
Enzymes [BR:bmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSUIS_B1248
Exosome [BR:bmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSUIS_B1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABY40182
UniProt: A9WWP6
Position
II:complement(1210301..1211485)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggttgcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaagggggatgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system