KEGG   Brucella suis ATCC 23445: BSUIS_B1429Help
Entry
BSUIS_B1429       CDS       T00638                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00860  Porphyrin and chlorophyll metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUIS_B1429 (hemN)
Enzymes [BR:bmt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BSUIS_B1429 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C CbiC
Motif
Other DBs
NCBI-ProteinID: ABY40348
UniProt: A9WXD2
Position
II:complement(1396132..1397484)
Genome map
AA seq 450 aa AA seqDB search
MSQTIVEKYGEARLPRYTSYPTAPNFKAEIVPGAYGRWLNSIPDDQDTSLYLHIPFCRSM
CWYCGCHTTITEKDRPILDYLDVLHKEIEMIARQRGRSFNLGEIHFGGGTPTIIQPDEFV
ALMAALRDRLGFAGELNAAVEIDPRRMTPEMAAALAYSGITRASLGVQSFDPKVQKAINR
IQTAKTTLETVSSLRKNNIQAINFDLIYGLPHQTVASCIETVDIAVEMRPNRFAVFGYAH
VPGFKKHQRLIDEKALPDVQARHAQAAAIAERLVEAGYEQIGLDHFALPDDDLSIAQREG
RLHRNFQGYTTDACKTLIGIGASAIGRFGNGYHQNIVPPGLYASCVASGELPTAKIYELT
AEDRVRADVIEQLMCNFSVNVAAVCAAHGFDPEVLMKQNDTLDELEKDGLVQREGFMVRV
DGRHRFIVRAVASAFDAYLASSKTNFSKTA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagacaatcgtggaaaaatatggcgaggcgcggctaccccggtatacgagctac
ccgacggctcccaatttcaaggccgagattgtgcccggtgcctatgggcgctggctgaat
tcgatcccggacgatcaggacacctcgctttatcttcatattccgttttgccggtctatg
tgctggtattgcgggtgccacaccacgattacggagaaagaccggccgatcctcgattat
ctcgatgttctgcacaaggaaatcgagatgatagccaggcaacgcggccgcagtttcaat
ctcggtgaaattcattttggcggcggaacgccgaccatcattcagcccgatgaattcgtc
gcactcatggcggcccttcgagaccggctcggctttgccggggaattgaatgcagcggtg
gagatcgatccgcgccggatgacgcctgaaatggccgcagccctggcatattccggcata
acgcgggcaagtcttggtgtgcagagcttcgaccccaaggtgcaaaaggcaatcaaccgc
attcaaacggccaagaccacgcttgaaaccgtctcaagcctgcggaagaacaatattcag
gcgataaacttcgaccttatctatgggttgccacatcagacggtggcatcctgcatcgag
acagtcgatatagcagttgagatgcggccaaaccggtttgcggtatttggctatgcgcat
gtgccgggtttcaaaaagcaccagagactgatcgatgagaaggcgcttcccgatgtgcag
gcgcggcacgcccaggcagcggcaattgccgagcgtctggttgaggccggttacgaacag
atcggtctggatcatttcgcgctgccggatgatgatctctccatcgcccagcgcgagggg
cggctgcatcgcaatttccagggctataccaccgatgcctgcaagacgctgatcgggatc
ggcgcttctgcaattggcaggttcggcaatggctatcatcagaatatcgttcctccgggg
ctttatgcgagctgtgttgcatcgggtgaactgcccaccgccaagatttatgaactgacg
gcggaggaccgggtgagggccgatgtgattgaacagctcatgtgcaatttctcggtcaat
gtcgccgcagtctgcgctgcacacggcttcgacccggaagtgctgatgaagcaaaacgac
acgctggatgaactggagaaagacggcctcgtgcagcgggaagggtttatggttcgcgtg
gatggcaggcatcgcttcatcgtgcgcgccgttgcatcggctttcgatgcctatctggcc
agctcgaaaacaaacttcagcaagactgcctga

DBGET integrated database retrieval system