KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0446Help
Entry
Bmul_0446         CDS       T00624                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00260  Glycine, serine and threonine metabolism
bmu00680  Methane metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
bmu01230  Biosynthesis of amino acids
Module
bmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmu_M00002  Glycolysis, core module involving three-carbon compounds
bmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_0446
  Energy metabolism
   00680 Methane metabolism
    Bmul_0446
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmul_0446
Enzymes [BR:bmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bmul_0446
Membrane trafficking [BR:bmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bmul_0446
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bmul_0446
  Exosomal proteins of melanoma cells
   Bmul_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABX14141
Position
1:complement(491822..492634)
Genome map
AA seq 270 aa AA seqDB search
MADPAAGPARRAPLPSLPTARSMYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQ
AGELLKEAGYTFDIAYTSVLKRAIRTLWHVQDRMDLMYLPVVHSWRLNERHYGALSGLNK
AETAAKFGDDQVLVWRRSYDTPPPALEPTDERAPYNDPRYAKVPREQLPLTECLKDTVAR
VLPLWNESIAPAIRAGKQVLIAAHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDE
NLKPIKHYYLGDQEAIAKAQAAVAKQGKAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggctgcgggccccgcgcgacgcgcaccgcttccttcactaccgaccgca
agatccatgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaac
cgcttcaccggctgggtcgacgtcgacctcaccgaacagggtcgcaacgaggcctatcag
gccggcgaactgctcaaggaagccggctacacgttcgacatcgcgtacacgtcggtgctc
aagcgcgcgatccgcacgctgtggcacgtgcaggaccggatggatctcatgtatctgccg
gtcgtccattcgtggcgactgaacgagcgccactacggtgcgctgtcgggcctgaacaag
gctgaaacggccgccaagttcggcgacgaccaggtgctcgtctggcgccgcagctacgac
acgccgccgcccgcgctggaaccgaccgacgagcgcgcgccgtacaacgatccgcgctac
gcgaaggtgccgcgcgagcagctgccgctcaccgagtgcctgaaggacacggtcgcccgc
gtgctgccgctctggaacgagtcgatcgcgccggcgatccgcgcgggcaagcaggtgctg
atcgcggcgcatggcaattcgctgcgcgcgctcatcaagtacctcgacggcatctcggac
agcgacatcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgaactcgacgag
aacctgaagccgatcaagcactattacctcggcgaccaggaagcgatcgcgaaggcgcag
gccgcggtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system