KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0672Help
Entry
Bmul_0672         CDS       T00624                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00030  Pentose phosphate pathway
bmu00051  Fructose and mannose metabolism
bmu00680  Methane metabolism
bmu00710  Carbon fixation in photosynthetic organisms
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
bmu01230  Biosynthesis of amino acids
Module
bmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_0672
   00030 Pentose phosphate pathway
    Bmul_0672
   00051 Fructose and mannose metabolism
    Bmul_0672
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bmul_0672
   00680 Methane metabolism
    Bmul_0672
Enzymes [BR:bmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Bmul_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ABX14367
UniProt: A0A0H3KHA3
Position
1:735548..736612
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRQLLDHAAEHGYGLPAFNVNNLEQVQAIMAAADQVGAPVIMQASAGARKYAGEP
FLRHLIEAAVESYPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMMDGSLEADGKTVASYEY
NVDVSRKVVEMAHSIGVTVEAELGVLGSLETMKGDKEDGHGAEGTMTREQLLTDPEQAAD
FVKLTQCDALAIAIGTSHGAYKFTKKPTGDILSIQRIKEIHARIPNTHLVMHGSSSVPQE
LLAEIREFGGDMKETYGVPVEEIQEGIKHGVRKVNIDTDLRLAITGAIRRYMFENPSKFD
PRDYLKPAREAAKKVCVDRYLAFGCEGQAAKIKPVPLEKIAEKYKSGELAQVVR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtatcaatgcgtcaattgctggaccacgcggcagagcacggttacggcctg
ccggccttcaacgtgaacaacctggagcaggtccaggcgatcatggcggccgcggaccag
gtcggcgcgcccgtgatcatgcaggcatcggccggcgcgcggaaatatgcgggcgagccg
ttcctgcgccacctgatcgaagcggctgtcgagtcgtatccgcacatcccggtcgtgatg
caccaggatcacggccagtcgccggcggtctgcatggccgcgatccgcagcggcttcacg
agcgtgatgatggacggttcgctcgaagcggacggcaagacggtcgcctcgtacgagtac
aacgtcgacgtgtcgcgcaaggtcgtcgagatggcgcactcgatcggcgtgacggtcgaa
gcggaactcggcgtgctcggctcgctcgagacgatgaagggcgacaaggaagacggtcac
ggcgcggaaggcacgatgacgcgcgagcagctgctgaccgatccggagcaggccgccgac
ttcgtgaagctcacgcagtgcgacgcgctcgcgatcgcgatcggtacgtcgcacggcgcg
tacaagttcacgaagaagccgacgggcgacatcctgtcgatccagcgcatcaaggaaatc
cacgcacgcattccgaacacgcacctcgtgatgcacggttcgtcgtcggtgccgcaggaa
ctgctcgccgagatccgcgaattcggcggcgacatgaaggaaacctacggcgtgccggtc
gaggaaatccaggaaggcatcaagcacggcgtgcgcaaggtcaacatcgacaccgacctg
cgtctcgcgattaccggcgcgatccgccgctacatgttcgagaacccgtcgaagttcgac
ccgcgcgactatctgaagcccgcgcgcgaagcggcgaagaaggtctgcgtcgaccgctac
ctcgcgttcggctgcgaaggccaggcagcgaagatcaagccggtgccgctcgagaagatc
gccgagaagtacaagtccggcgagctcgcgcaggtcgtgcgctga

DBGET integrated database retrieval system