KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0857Help
Entry
Bmul_0857         CDS       T00624                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00450  Selenocompound metabolism
bmu00970  Aminoacyl-tRNA biosynthesis
bmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Bmul_0857
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bmul_0857
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmu01007]
    Bmul_0857
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmu03016]
    Bmul_0857
Enzymes [BR:bmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Bmul_0857
Amino acid related enzymes [BR:bmu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Bmul_0857
Transfer RNA biogenesis [BR:bmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Bmul_0857
 Prokaryotic type
   Other AARSs
    Bmul_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABX14551
UniProt: A9AHJ8
Position
1:complement(935532..937700)
Genome map
AA seq 722 aa AA seqDB search
MSASDLTSVQAAAPQGRRQILVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYY
IGADDTHGTPVMLRAEKEGLTPKQLIERVWAEHKRDFDSFGVSFDNFYSTDSEENRQLSE
KIYLALKDNGLIAEREIEQAYDPVKEMFLPDRFIKGECPKCHAKDQYGDSCEVCGSTYLP
TELLNPYSVVSGATPVRKTSKHYFFRLSDPRCETFLREWVSGLAQPEATNKMREWLGDAG
EAKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCDRKGIDFDAWIRAG
SSAEQYHFIGKDILYFHTLFWPAMLQFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQ
SYIDTGLNPEWLRYYFAAKLNATMEDIDLNLDDFQARVNSDLVGKYVNIASRAAGFLIKR
FDGRVQDSAMNHPLVAKLREAIPQIAAHYEAREYGRALRHTMELADEVNAYVDGAKPWEL
AKDPANAVALHETCSVSLEAFRLLSLALKPVLPRVAEAVEAFFGIAPLAWADAAKPLSSA
QPIKAYQHLMTRVDAKQIEALLAANRDSLQADATAAGGAGAATAKGAKAAKADAKPVSAK
APAANGADDATISIDDFAKIDLRIAKIVACQAVEGSDKLLQLTLDVGEEKTRNVFSGIKS
AYQPEQLVGKLTVMVANLAPRKMKFGLSEGMVLAASATDEKAEPGLYILEPHSGAKPGMR
VK
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatccgacctcacttccgtgcaggccgcggcgccgcaaggccgccgccagatc
ctcgtcacgtccgccctgccctacgccaacggccagatccatatcggccatctggtcgag
tacatccagaccgacatctgggtgcggacgctgcgaatgcacgggcacgaggtctactac
atcggcgccgacgacacgcacggcacgccggtcatgctgcgcgcggagaaggaaggcctg
acgccgaagcagctgatcgagcgcgtatgggccgagcacaagcgcgacttcgacagcttc
ggcgtgtcgttcgacaacttctactcgaccgattcggaagaaaaccgccagctgagcgag
aagatctacctcgcgctgaaggacaacgggctgatcgccgagcgcgagatcgagcaggcg
tacgacccggtcaaggagatgttcctgccggaccgtttcatcaagggcgagtgcccgaag
tgccacgcgaaggaccagtacggcgacagctgcgaagtgtgcggctcgacctacctgccg
accgagctgctgaacccgtattcggtcgtgtcgggcgcgacgcccgtgcgcaagacgtcg
aagcactacttcttccgcctgtccgacccgcgctgcgagacgttcctgcgcgaatgggtg
agcggcctcgcgcagcccgaagcgaccaacaagatgcgcgaatggctcggcgacgccggc
gaagccaagctcgccgactgggacatctcgcgcgacgcaccgtatttcggcttcgagatc
cccggcgcgccgggcaagtacttctacgtgtggctcgatgcgccggtcggctactacgcg
agcttcaagaatctgtgcgatcgcaaaggcatcgacttcgatgcgtggatccgcgccggt
tcgagcgccgagcagtaccacttcatcggcaaggacatcctgtatttccacacgctgttc
tggccggcgatgctgcagttctcgggccaccgcacgccgaccaacgtgttcgcgcacggc
ttcctgaccgtcgacggcgcgaagatgtcgaagtcgcgcggcacgttcattaccgcgcag
agctatatcgacaccggcctgaaccccgaatggctgcgctactacttcgccgcgaagctg
aacgcgacgatggaagacatcgatctgaacctcgacgacttccaggcgcgcgtgaatagc
gacctcgtcggcaagtacgtgaacatcgcgagccgcgcggcgggctttctgatcaagcgc
ttcgacggccgcgtgcaggacagcgcgatgaaccatccgctcgtcgcgaagctgcgcgaa
gcgattccgcagatcgccgcgcactacgaggcgcgcgagtacggccgcgcgttgcgccac
acgatggaactcgccgacgaagtgaacgcctacgtcgacggcgccaagccgtgggagctc
gcgaaggatccggcgaacgcggtcgcgctgcacgaaacctgcagcgtgagcctcgaggcg
ttccgcctgctgtcgctcgcgctcaagcccgtgctgccgcgcgtggccgaagcggtcgag
gcgttcttcggcatcgcgccgctcgcgtgggccgatgccgcgaagccgctgtcgtccgcg
cagccgatcaaggcctaccagcacctgatgacgcgcgtcgacgcgaagcagatcgaagcg
ctgctcgccgccaaccgcgattcgctgcaggccgacgcaacggccgccggcggcgcgggc
gccgcgacggcgaagggtgcgaaagccgcgaaggccgatgcgaagccggtcagcgcgaaa
gcgcccgccgcgaacggtgccgacgacgcaacgatttcgatcgacgatttcgcgaagatc
gatctgcgcatcgcgaagatcgtcgcgtgccaggccgtcgaagggtcggacaagctgctg
cagctgacgctcgacgtcggcgaggagaagacgcgcaacgtgttctcggggatcaagtcc
gcgtatcagcccgagcagctcgtcggcaagctgacggtcatggtcgcgaacctcgcgccg
cgcaagatgaagttcgggctgtccgaagggatggtgctcgcggcctcggcgaccgacgag
aaggccgaaccggggctctatatcctcgagccgcacagcggcgcgaagcccggcatgcgc
gtgaagtaa

DBGET integrated database retrieval system