KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1436Help
Entry
Bmul_1436         CDS       T00624                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00020  Citrate cycle (TCA cycle)
bmu00620  Pyruvate metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Module
bmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_1436
   00020 Citrate cycle (TCA cycle)
    Bmul_1436
   00620 Pyruvate metabolism
    Bmul_1436
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bmul_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_5 PGAP1 Esterase Ndr DUF900 Abhydrolase_3 Ser_hydrolase LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: ABX15124
UniProt: A0A0H3KFB8
Position
1:1580253..1581368
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKSVGERVSKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAADVSDADIDAAIAAFQRDYTPSAAADEAAGPQPEKAQIGGR
TMRFLKLGDGAGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESGKAVERGS
LDELADAVLALLDAKDIERAHLIGHSMGGAVAMTVAERAPARVASLTLIASAGLGAEINR
DYIDGFVAGNSRNTLKPHLGALFADSALVTRQLVDDLVKYKRLEGVQAALEKIANAAFDG
ATQRRVFRDRLASLAPRTLVIWGERDQVIPAQHAHGLPDGVRTELIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaagtgggggctgtcgatggagcaggggcaggtc
aacggctggctgaagtcggtcggcgaacgcgtgtcgaagggcgacgaggtgctcgacgtc
gaaaccgacaagatctcgtcgggcgtcgaatgcgcattcgacggcacgctgcgccggcag
gtcgctcaggagggcgaaacgctgccggtcggggcgctgctcggcgtggtcgccgcggcc
gacgtgagcgatgccgacatcgacgcggcgatcgcggcattccagcgcgactacacgccg
agcgcggcggccgacgaagcggccggcccgcaaccggagaaggcgcagatcggcggccgc
acgatgcgcttcctgaagctcggcgacggcgccgggacgccggccgtgctgatccacggc
ttcggcggcgacctgaacaactggctgttcaatcatgcggaactggcggcgcaccggccg
gtgtgggcgctcgatctgcccggtcacggcgagtcgggcaaggcggtcgagcgcggcagc
ctcgacgagctcgccgacgccgtgctggcgctgctcgacgcgaaggacatcgaacgcgcg
cacctgatcggccattcgatgggcggcgcggtcgcgatgacggtcgccgagcgtgcgccg
gcgcgcgtcgcgtcgctgacgctgatcgcgagcgcgggcctcggtgccgagatcaaccgc
gactacatcgacggcttcgtcgccggcaacagccgcaatacgctgaagccgcatctcggc
gcgctgttcgcggacagcgcgctcgtcacgcgacagctcgtcgacgatctcgtcaaatac
aagcggctcgaaggcgtgcaggccgcgctcgagaagatcgcgaacgccgcgttcgacggc
gcgacgcagcggcgcgtgttccgcgaccggcttgcgtcgctcgcgccgcgcacgctcgtg
atctggggcgagcgcgaccaggtgattccggcgcagcacgcgcacggcttgccggacggc
gtgcgcaccgagctgatcgccggcagcgggcacatggtgcagatggaagcggcggccgac
gtgaaccggctgatcgtcgcgtttctcggagactga

DBGET integrated database retrieval system