KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2089Help
Entry
Bmul_2089         CDS       T00624                                 

Definition
(GenBank) exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Bmul_2089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bmu03400]
    Bmul_2089
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bmul_2089
DNA repair and recombination proteins [BR:bmu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bmul_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ABX15774
UniProt: A0A0H3KDF3
Position
1:complement(2289608..2292946)
Genome map
AA seq 1112 aa AA seqDB search
MLQLFYSNRHETLADALLDDLAAFPARNGPWAPQQIIVPSAALRRRLELDIAARHGVCAN
VEFTYLAQWLWTQIGRVLDVPARSPFAPDRLVWRCYRLFAQAPEHAPWLASPRLAAYLGA
SDDAMRYELAHRVATVLDHYLTYRPEWLAAWQAGESVLAADGAPRAIGEAARDDERWQAA
LWRALLAELSDSGAPPAHRFLVDARQIDADTIARIDWPESVSVFALPTMPPLHIALLREL
SRWIDVRVYALNPCREFWFDIVTAAHAEALDAAGRLDYQEVGHPLLAEWGRQTQAQLHML
HELTESAALGDASRFVENRAPTWLARVQNAILDLQPEAALGEPPAERGIEVHVCHSLARQ
LEVLHDRLLGWFDADPSLQPSDVLVAVADLAAAGPLIDAAFGTAGPGGARIPYRITGLPP
SQANPVARVLLDWLALPERQVGAPELVEWLRVDAVAARYGIDASALETVQTWLAAAGARR
GLAPVAHDDAAVPTPRHTFSDALARLFLGYAMPDGAAPVGAWLPIEAATGSEAELLGRLA
RFTDDLDGFARRLADAHTPRGWSELFADTLARFFDSGAAYADALAGVRDALDAMLAAMTE
GAADEALPAAVVRAGLAAALDDPARGGVPWGGVTFSSLTSLRGLPYRIVCLLGMDDGVLP
SLARADEFDLMAVLPKLGDRQRRDDERNLFLDLLLAARDRLLIAYTGRSIRDNAPLPPAA
LVDELLDHLALVTAGPNAAPEAVDAARRAFIVEHPLQPFAAAYFRPDSTIASYDAERAAL
ASLLASDASRDGPREQPFFAQPLPAEPAEPVPFGEFERFWRHPARALLRARLGIVLADAQ
AELLDTEPFALDFAGSDALAERVLPLLIESDEAAAHDHALRIADASPELPGGATGAVWRD
QALGSLAQLASNVRRALADGIERRPFSLTIAPAWPQAEHALFGADSEALARDATRAPFEL
QGTLNRLTQAGQIIYRYAKPSARDYLSAWLAHLVYCAVEPDGPRRTLWFGSGGAFELTPV
AAPLDRLAPLAALFRAGRRMPLRFFPRSAWARVTDGEAKAASVWINERVASEADDPAIAI
AWRGAQPSLDEPFGTLARLVFEPLVEHLKEVA
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgctccagctcttctattcgaatcgccacgaaacgctggccgacgcgctgctcgacgat
ctcgccgcgttcccggcccgcaacggcccgtgggcgccgcagcagatcatcgtgccgagc
gccgcgctgcgtcgccgtctcgagctcgacatcgccgcgcggcacggcgtgtgcgcgaat
gtcgagttcacgtatctcgcgcaatggctgtggacgcaaatcggccgcgtgctcgacgtg
cccgcgcgttcgccgttcgcgcccgaccggctcgtgtggcgctgctaccggttgttcgcg
caggcgccggagcatgcgccgtggctggcgtcgccgcggctggccgcgtatctcggcgcg
tcggacgacgcgatgcgctacgagctcgcgcatcgcgtcgccaccgtgctcgaccattac
ctgacctatcgtcccgaatggctggccgcctggcaggccggcgaatcggtgctcgcggcc
gacggcgcgccgcgtgcgatcggcgaggccgcacgcgacgacgagcgctggcaggccgcg
ctctggcgcgcgctgctcgcggagctgagcgatagcggcgcgccgcctgcgcatcgtttt
ctcgtcgacgcgcggcagatcgatgccgacacgatcgcacgaatcgactggcccgaatcg
gtcagcgtgttcgcgctgccgacgatgccgccgctgcacatcgcgctgctgcgcgagctg
tcgcgctggatcgacgtgcgcgtgtacgcgctgaatccgtgccgcgaattctggttcgac
atcgtgacggccgcgcatgcggaagcgctcgatgcggcgggccggctcgactatcaggaa
gtcggccatccgctgctcgcggagtggggcaggcagacgcaggcgcagctgcacatgctg
cacgagctgactgaaagcgcggcgctcggcgatgcgtcgcggttcgtcgagaatcgcgcg
ccgacctggctcgcgcgcgtacagaacgcgatcctcgatctgcagccggaagccgcgctc
ggcgagccgccggccgaacgcgggatcgaggtgcacgtgtgccacagtctcgcgcgtcag
ctcgaggtgctgcacgaccgtctgctcggctggttcgatgccgatccgagcctgcagccg
tccgacgtgctggtcgcggtggccgatctcgcggcggccgggccgctgatcgacgcggcg
ttcggcacggccggcccgggcggcgcgcgcatcccttatcggatcaccgggctgccgccg
tcacaggcgaacccggtcgcgcgcgtgctgctcgactggctcgcgctgcccgaacgtcag
gtcggcgcgcccgagctcgtcgaatggctgcgcgtcgatgcggtggccgcgcgctacggg
atcgacgcgagcgcgctcgaaaccgtgcagacctggctggcggctgccggcgcgcggcgc
gggctcgcgccggtcgcgcacgacgacgcggccgtaccgacgccgcgccacacgttctcc
gatgcgctggcgcgcctctttctcggttacgcgatgccggacggcgcagcgccggtcggc
gcgtggctgccgatcgaagcggcaaccggcagcgaagcggaactgctcggccggctcgcg
cgcttcaccgacgatctcgacggtttcgcgcggcggctcgccgatgcgcatacgccgcgc
ggctggagcgaactgttcgccgacacgctcgcgcgcttcttcgattcgggcgccgcgtat
gcggatgcgcttgccggcgtgcgcgacgcgctcgacgcgatgctcgccgcgatgaccgaa
ggcgcggccgacgaagcgctgcccgcggccgtcgtgcgcgcggggctcgcggcggcgctc
gacgatccggcgcgcggcggcgtgccgtggggcggcgtcacgttctcgtcgctgacgagc
ctgcgcgggctgccgtatcggatcgtctgcctgctcggcatggacgacggcgtgctgccg
agcctcgcgcgcgccgacgaattcgacctgatggccgtgctgccgaagctcggcgaccgt
cagcgccgcgacgacgagcgcaatctgttcctcgacctgctgctcgccgcacgcgaccgg
ctgctgatcgcctacacggggcgcagcattcgcgacaacgcaccattgccgcccgcggcg
ctcgtcgacgaactgctcgaccatctcgcgctcgtcacggccggcccgaacgcggcgccc
gaggcggtcgacgccgcgcgccgcgcgttcatcgtcgagcatccgctgcaaccgttcgcg
gctgcctacttccggcccgacagcacgatcgcgtcgtacgatgccgagcgcgcggcgctg
gcctcgctgctcgcgagcgacgcgtcgcgcgacgggccgcgcgagcagccgttcttcgca
cagccgctgccggccgagccggcggagccggtgccgttcggcgaattcgagcgcttctgg
cgccatccggcgcgcgcgctgctgcgtgcgcggctcggcatcgtgcttgccgatgcccag
gccgagctgctcgacaccgaaccattcgcgctcgacttcgcgggcagcgatgcgctcgcg
gagcgcgtgctgccgctgctgatcgaatcggacgaagccgccgcgcacgatcatgcgttg
cgtatcgcggatgcgagccccgaactgccgggcggcgcgacgggcgccgtgtggcgcgac
caggcgctcggctcgctcgcgcagctcgcctcgaacgtgcgccgcgcgcttgccgacggc
atcgagcggcgcccgttctcgctgacgatcgcgcccgcgtggccgcaggccgagcacgcg
ctgttcggcgccgacagcgaggcgctcgcgcgtgacgcgacgcgcgcgccgttcgagctg
cagggcacgctgaaccggctgacgcaagccggacagatcatctatcgctatgcgaagccg
agcgcgcgcgactatctgtccgcgtggctcgcgcatctcgtctattgcgccgtcgaaccc
gacgggccgcgacgtacgctgtggttcggcagcggcggcgcattcgagctgacgccggtc
gccgcgccgctcgatcggctcgcgccgctggccgcgctgtttcgcgcgggtcgccggatg
ccgctgcggtttttcccgcgcagcgcctgggcgcgcgtgaccgacggcgaagcgaaggcc
gcgagcgtgtggatcaacgagcgcgtcgcgagcgaggcggacgatccggccatcgcgatc
gcctggcgcggtgcgcagccgtcgctcgacgagccgttcggcacgctggcgcggctcgtg
ttcgagccgctcgtcgaacatttgaaggaggtcgcatga

DBGET integrated database retrieval system