KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2354
Entry
Bmul_2354         CDS       T00624                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bmul_2354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_2354
Secretion system [BR:bmu02044]
 Type IV secretion system
  Trb secretion system protein
   Bmul_2354
SSDB
Motif
Pfam: DUF4141 DUF2749
Other DBs
NCBI-ProteinID: ABX16039
Position
1:2563885..2564613
AA seq 242 aa
MKIRLLTLTVAALIGVMPAAQAQWVVVDPTNLVQNTLTAIRTMEQINNQINQLQNEAQML
INQARNLASLDFNIVNRLRSTLATTERLIAEAQGLAYDVQSMDATFARLYPEQYAATISG
DRMAQDARERWKNTLDGLHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAQQATN
QLLALQAKQSIQSQQLQITQDRAASLELARQAAATERAREVRRRFLGSGTPYTPQSVNFY
NN
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaagattcgccttctcactctcactgttgctgcgttgatcggtgtcatgcccgctgcg
caggcgcagtgggttgtcgttgatccgaccaacctcgtgcagaacacgctgaccgccatt
cgcacgatggagcagatcaacaaccagatcaatcaactgcaaaacgaggcgcagatgttg
ataaaccaggcccgcaatctggcgagcctcgatttcaacatcgtcaaccgcctgcgctcc
acgctcgccaccaccgaacgcctgatcgccgaggcgcagggactggcctacgacgtgcag
agcatggatgccacgtttgcccgtctgtacccggagcagtacgccgcgaccattagcggc
gaccgcatggcgcaggacgcccgcgaacgctggaagaacacgctcgatggcttgcatacc
gcgatgcggatgcaggcacaggtgtcgcagaacctggcccaagacgaaagcgcgctggcc
gacctcgtgagccaaagccagtcggccaccggcgccctgcaggcgcagcaggcgaccaac
cagcttctggccttgcaggccaagcagtcgatccagtcccagcagctccagatcacgcaa
gaccgggcggcctcgctggaactggcgcggcaggcggcggcgaccgagcgcgcccgcgaa
gtgcggcggcgcttcctcggcagcggcacgccgtacacgccgcagtccgtcaatttctac
aacaactga

DBGET integrated database retrieval system