KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2358
Entry
Bmul_2358         CDS       T00624                                 
Name
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bmul_2358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_2358
Secretion system [BR:bmu02044]
 Type IV secretion system
  Trb secretion system protein
   Bmul_2358
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ABX16043
Position
1:2567032..2568033
AA seq 333 aa
MNLPFRFYAFVLMFAALSGCASQGKPPPTISLDEPVQAQPLPEPPKPVEVVAVPEPLALP
AQLKPLPKLDEAATAPEPADEKMRVSRANAEARIAPTREGYVNAIQVWPYSDGALYQVYA
APGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGSGEALRVNVLVKPTRSGLKTNLVIT
TSRRTYLLELTSTEKAWMASVSWDYPKDRMLALQRQAQAAQTAAPVDTGLALEKIRFRYT
ISGSNPPWKPQRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQGDGQLVNYRFRSPYYIVD
RLFGAAELRLGGDGGDVVRIERTDGAVGAARRN
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaacctgcctttccgcttttacgctttcgtgctgatgttcgcagctctgtcgggttgc
gcctcgcaaggcaagccaccgccgaccatctcgctcgatgagccagtgcaggcgcagccg
ctgcccgaaccgcccaagccggtcgaagtcgtcgccgtgcccgagccactggcgctgccg
gcgcagttgaagccgctgccgaagctggacgaggcagcgaccgcgccggagccggccgac
gagaagatgcgcgtctcgcgcgccaatgccgaggcgcgcatcgcgccgacccgcgagggc
tacgtcaacgcgattcaggtgtggccgtatagcgacggcgcgttgtatcaggtctatgcg
gcaccggggcgcgtcaccgtggtttcgctccagcctggcgaggaactggtgacggtcgcc
gctggcgataccgtgcgctggatcgtcggcgacacgtccagcggcagcggcgaggcgttg
cgcgtcaatgtgctagtcaagcccacccgttcgggcctgaaaaccaatctggtcatcacc
accagccggcggacgtacctgctggaactgacttcgaccgagaaggcatggatggcctcg
gtgtcatgggactacccgaaagaccggatgctggccttgcagcgccaggcgcaggctgca
cagacagccgcgccggtcgataccggcctggcgttggagaagatccgcttccgctacacg
atcagcggcagcaatccgccgtggaagccgcagcgggccttcgatgatggcgagaaggtc
tacatccagttcccgccgggcatcgcgcaaggcgaactgccgccgctgttcgtcatcggc
gcgcagggtgacgggcaactggtcaattaccgtttccgttcgccgtactacatcgtggat
cgactctttggtgcggccgaactgcgcctgggtggcgatggtggtgacgtggtgcggatc
gagcgcaccgacggggctgtgggcgcagcgcggaggaactga

DBGET integrated database retrieval system