KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2479Help
Entry
Bmul_2479         CDS       T00624                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bmul_2479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD PrmA MTS Methyltransf_31 Met_10 Methyltransf_11 Methyltransf_12 Methyltransf_18 Methyltransf_23 Spermine_synth Ubie_methyltran Methyltransf_32 TPMT Methyltr_RsmB-F Glucokinase Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: ABX16163
UniProt: A0A0H3KCM5
Position
1:2693799..2694452
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDLDVLGLLSIVKRENFVPAEYRDLAFADLELPLPGGRKM
LFPRVEARVLQELAVKKHENVLVIGAGSGYLTALIAHRALHVTAVEIDPTIAKFAADNLR
ENAVTNAEVVLGDGSLGWPDKAPYDVICVAGGLPVVPQQMLEQLKIGGRLSAFVGGRPVM
KAQVITRIDEKQYRVADVFETYVDHLVNAMEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcgcgtttcaacatgatcgaacagcagatccggccgtgggacgtg
ctggatctggacgtcctgggcctgctgtcgatcgtcaagcgtgagaatttcgttccggcc
gaataccgcgatctcgcgttcgccgatcttgaactgccgctgcccggcggccgcaagatg
ctgttcccgcgcgtcgaagcgcgcgtgctgcaggaactggccgtcaagaagcacgagaac
gtgctcgtgatcggcgcgggctccggctacctgaccgcgctgatcgcacaccgcgcgctg
cacgtcacggcggtcgagatcgacccgacgatcgcgaagttcgcggccgacaacctgcgc
gagaacgccgtgacgaacgcggaagtcgtgctcggcgacggttcgctcggctggcccgac
aaggcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcagcagatg
ctcgaacagctgaagatcggcggccgcctgtcggcgttcgtcggcggccggccggtaatg
aaggcgcaggtgatcacgcgcatcgacgagaagcagtatcgcgtcgcggacgtgttcgaa
acctacgtcgaccacctcgtcaacgcgatggaaccgtcgcgcttcaagttctga

DBGET integrated database retrieval system