KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2928
Entry
Bmul_2928         CDS       T00624                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bmul_2928
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_2928
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_2928
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABX16612
UniProt: A0A0H3KBS7
Position
1:complement(3203947..3204450)
AA seq 167 aa
MLHMHMQFGSPAIKGESADKDHQGWIELKSWDHSIIQPRSATASTAGGHTATRCEHGDMI
FTKEIDSSSPLLYQHASGGTTFDEVTIHFSRADGEGKRVQYLEIKLKYVIISSIAPSVRE
EGLPVETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttacacatgcacatgcagtttggtagtccggcgatcaaaggcgaatccgcggacaag
gaccaccagggctggatcgaactgaaatcgtgggatcactcgatcatccagccgcgttcg
gcgaccgcgtcgaccgcaggcggccacaccgccacgcgttgcgagcacggcgacatgatc
ttcacgaaggaaatcgattcgtcgagcccgctgctgtatcagcacgcgtcgggcggcacg
acgttcgacgaagtgacgattcatttctcgcgtgcggacggcgaaggcaagcgtgtccag
tatctggaaatcaagctcaagtacgtgatcatctcgagcatcgcgccgagcgtgcgcgag
gaaggcctgccggtcgagacgttctcgctgaagtatgcggccgtgcagtggaagcagacg
cagcagaagatcggcggcaaccagggcggcaacacgcagggcgcctggagcctgacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system